![Immunohistochemistry-Paraffin: FUBP1 Antibody [NBP1-83918] - Staining in human lymph node and skeletal muscle tissues.. Corresponding FUBP1 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/FUBP1-Antibody-Immunohistochemistry-Paraffin-NBP1-83918-img0018.jpg "Immunohistochemistry-Paraffin: FUBP1 Antibody [NBP1-83918] - Staining in human lymph node and skeletal muscle tissues.. Corresponding FUBP1 RNA-seq data are presented for the same tissues.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC, KD |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: GGGGVNDAFKDALQRARQIAAKIGGDAGTSLNSNDYGYGGQKRPLEDGDQPDAKKVAPQNDSFGTQLPPMHQQQRSVMTEEYKVPDGMVGFIIGRGGEQISRIQQESGCKIQIAPDSGGLPERSCML |
| Marker | Nucleus without Nucleoli Marker |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | FUBP1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Flow Cytometry FOLR1 Antibody (548908) [Unconjugated]](https://images.novusbio.com/images2/FOLR1_MAB5646_Flow_Cytometry_10781.jpg)
![Western Blot FOLR1 Antibody (548908) [Unconjugated]](https://images.novusbio.com/images2/FOLR1_MAB5646_Western_Blot_6248.jpg)
![Immunocytochemistry FOLR1 Antibody (548908) [Unconjugated]](https://images.novusbio.com/images2/FOLR1_MAB5646_Immunocytochemistry_6624.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for FUBP1 Antibody (NBP1-83918)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | FUBP1 |
![Western Blot: FUBP1 Antibody [NBP1-83918] - Analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1,. Remaining relative intensity is presented. Loading control: Anti-GAPDH.](http://images.novusbio.com/fullsize/FUBP1-Antibody-Western-Blot-NBP1-83918-img0022.jpg "Western Blot: FUBP1 Antibody [NBP1-83918] - Analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1,. Remaining relative intensity is presented. Loading control: Anti-GAPDH.")
![Immunocytochemistry/Immunofluorescence: FUBP1 Antibody [NBP1-83918] - Staining of human cell line U-2 OS shows localization to nucleoplasm.](http://images.novusbio.com/fullsize/FUBP1-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-83918-img0015.jpg "Immunocytochemistry/Immunofluorescence: FUBP1 Antibody [NBP1-83918] - Staining of human cell line U-2 OS shows localization to nucleoplasm.")
![Immunohistochemistry-Paraffin: FUBP1 Antibody [NBP1-83918] - Staining of human skeletal muscle shows strong nuclear positivity in myocytes.](http://images.novusbio.com/fullsize/FUBP1-Antibody-Immunohistochemistry-Paraffin-NBP1-83918-img0020.jpg "Immunohistochemistry-Paraffin: FUBP1 Antibody [NBP1-83918] - Staining of human skeletal muscle shows strong nuclear positivity in myocytes.")
![Western Blot: FUBP1 Antibody [NBP1-83918] - Analysis in human cell line SH-SY5Y.](http://images.novusbio.com/fullsize/FUBP1-Antibody-Western-Blot-NBP1-83918-img0008.jpg "Western Blot: FUBP1 Antibody [NBP1-83918] - Analysis in human cell line SH-SY5Y.")
![Western Blot: FUBP1 Antibody [NBP1-83918] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.](http://images.novusbio.com/fullsize/FUBP1-Antibody-Western-Blot-NBP1-83918-img0009.jpg "Western Blot: FUBP1 Antibody [NBP1-83918] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.")
![Immunohistochemistry-Paraffin: FUBP1 Antibody [NBP1-83918] - Staining of human fallopian tube shows strong nuclear positivity in glandular cells.](http://images.novusbio.com/fullsize/FUBP1-Antibody-Immunohistochemistry-Paraffin-NBP1-83918-img0016.jpg "Immunohistochemistry-Paraffin: FUBP1 Antibody [NBP1-83918] - Staining of human fallopian tube shows strong nuclear positivity in glandular cells.")
![Immunohistochemistry-Paraffin: FUBP1 Antibody [NBP1-83918] - Staining of human lymph node shows strong nuclear positivity in germinal center cells.](http://images.novusbio.com/fullsize/FUBP1-Antibody-Immunohistochemistry-Paraffin-NBP1-83918-img0017.jpg "Immunohistochemistry-Paraffin: FUBP1 Antibody [NBP1-83918] - Staining of human lymph node shows strong nuclear positivity in germinal center cells.")
![Immunohistochemistry-Paraffin: FUBP1 Antibody [NBP1-83918] - Staining of human endometrium shows strong nuclear positivity in glandular cells.](http://images.novusbio.com/fullsize/FUBP1-Antibody-Immunohistochemistry-Paraffin-NBP1-83918-img0019.jpg "Immunohistochemistry-Paraffin: FUBP1 Antibody [NBP1-83918] - Staining of human endometrium shows strong nuclear positivity in glandular cells.")
![Western Blot Lyp/PTPN22 Antibody [Unconjugated]](https://images.novusbio.com/images2/Lyp_AF3428_Western_Blot_5296.jpg)
![Simple Western Lyp/PTPN22 Antibody [Unconjugated]](https://images.novusbio.com/images2/Lyp_AF3428_Simple_Western_16762.jpg)
![Immunocytochemistry Lyp/PTPN22 Antibody [Unconjugated]](https://images.novusbio.com/images2/Lyp_AF3428_Immunocytochemistry__Immunofluorescence_17421.jpg)
![Western Blot Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Western_Blot_5287.jpg)
![Simple Western Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Simple_Western_16990.jpg)
![Knockout Validated Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Knockout_Validated_24032.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")