![Western Blot: FoxM1 Antibody [NBP1-84671] - Primary AML mononuclear cells were obtained from patients with newly diagnosed or relapsed AML. Mononuclear cells were supplemented by CD34 expansion supplement for 24 hours in the presence of drug or 0.1% DMSO. Cells were then harvested for Western blot. Treated cells were harvested and lysed using IP buffer. Protein concentration was determined. Isolated proteins were separated on SDS-PAGE and transferred to PVDF membrane. Immunoblotting was carried out with antibodies specific for FOXM1 and B-actin. This image was submitted via customer review.](http://images.novusbio.com/fullsize/FoxM1-Antibody-Western-Blot-NBP1-84671-img0004.jpg "Western Blot: FoxM1 Antibody [NBP1-84671] - Primary AML mononuclear cells were obtained from patients with newly diagnosed or relapsed AML. Mononuclear cells were supplemented by CD34 expansion supplement for 24 hours in the presence of drug or 0.1% DMSO. Cells were then harvested for Western blot. Treated cells were harvested and lysed using IP buffer. Protein concentration was determined. Isolated proteins were separated on SDS-PAGE and transferred to PVDF membrane. Immunoblotting was carried out with antibodies specific for FOXM1 and B-actin. This image was submitted via customer review.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: GIAPLSSAGPGKEEKLLFGEGFSPLLPVQTIKEEEIQPGEEMPHLARPIKVESPPLEEWPSPAPSFKEESSHSWEDSSQSPTPRPKKSYSGL |
| Marker | Mitosis Marker |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | FOXM1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
||
| Reviewed Applications |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Western Blot AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/Akt3_AF887_Western_Blot_5930.jpg)
![Simple Western AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/16332.jpg)
![Intracellular Staining by Flow Cytometry AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/Akt3_AF887_Flow_Cytometry_8283.jpg)
| Publications using NBP1-84671 | Applications | Species |
|---|---|---|
| Khan I, Halasi M, Patel A et al. FOXM1 contributes to treatment failure in acute myeloid leukemia JCI Insight 2018-08-09 [PMID: 30089730] (WB, Human) | WB | Human |
| Halasi M, Hitchinson B, Shah BN et al. Honokiol is a FOXM1 antagonist Cell Death Dis 2018-01-24 [PMID: 29367668] (WB, Human) | WB | Human |
| Images | Ratings | Applications | Species | Date | Details | ||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Enlarge |
reviewed by:
Verified Customer |
WB | Human | 01/08/2019 |
Summary
|
||||||||
Enlarge |
reviewed by:
Verified Customer |
WB | Human | 02/14/2018 |
Summary
|
Secondary Antibodies |
Isotype Controls |
Research Areas for FoxM1 Antibody (NBP1-84671)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
5 | |
4 | |
3 | |
2 | |
1 |
| Verified Customer 01/08/2019 |
||
| Application: | WB | |
| Species: | Human |
| Verified Customer 02/14/2018 |
||
| Application: | WB | |
| Species: | Human |
| Gene Symbol | FOXM1 |
![Immunohistochemistry-Paraffin: FoxM1 Antibody [NBP1-84671] - Staining of human uterine cervix shows moderate nuclear positivity in a subset of epidermal cells.](http://images.novusbio.com/fullsize/FoxM1-Antibody-Immunohistochemistry-Paraffin-NBP1-84671-img0008.jpg "Immunohistochemistry-Paraffin: FoxM1 Antibody [NBP1-84671] - Staining of human uterine cervix shows moderate nuclear positivity in a subset of epidermal cells.")
![Immunohistochemistry-Paraffin: FoxM1 Antibody [NBP1-84671] - Staining of human rectum shows moderate nuclear positivity in a subset of glandular cells.](http://images.novusbio.com/fullsize/FoxM1-Antibody-Immunohistochemistry-Paraffin-NBP1-84671-img0005.jpg "Immunohistochemistry-Paraffin: FoxM1 Antibody [NBP1-84671] - Staining of human rectum shows moderate nuclear positivity in a subset of glandular cells.")
![Immunohistochemistry-Paraffin: FoxM1 Antibody [NBP1-84671] - Staining of human skeletal muscle shows no nuclear positivity in striated muscle fibers as expected.](http://images.novusbio.com/fullsize/FoxM1-Antibody-Immunohistochemistry-Paraffin-NBP1-84671-img0006.jpg "Immunohistochemistry-Paraffin: FoxM1 Antibody [NBP1-84671] - Staining of human skeletal muscle shows no nuclear positivity in striated muscle fibers as expected.")
![Immunohistochemistry-Paraffin: FoxM1 Antibody [NBP1-84671] - Staining of human testis shows moderate nuclear positivity in few cells in seminiferous ducts.](http://images.novusbio.com/fullsize/FoxM1-Antibody-Immunohistochemistry-Paraffin-NBP1-84671-img0007.jpg "Immunohistochemistry-Paraffin: FoxM1 Antibody [NBP1-84671] - Staining of human testis shows moderate nuclear positivity in few cells in seminiferous ducts.")
![Immunocytochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/Insulin_MAB1417_Immunocytochemistry_9376.jpg)
![Immunohistochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/mab1417_human-bovine-mouse-insulin-mab-clone-182410-immunohistochemistry-308202115145.jpg)
![Chromatin Immunoprecipitation (ChIP) HNF-3 beta/FoxA2 Antibody [Unconjugated]](https://images.novusbio.com/images2/HNF-3_beta_AF2400_Chromatin_Immunoprecipitation_11227.jpg)
![Immunocytochemistry HNF-3 beta/FoxA2 Antibody [Unconjugated]](https://images.novusbio.com/images2/HNF-3_beta_AF2400_Immunocytochemistry_6484.jpg)
![Immunohistochemistry HNF-3 beta/FoxA2 Antibody [Unconjugated]](https://images.novusbio.com/images2/HNF3_beta_AF2400_Immunohistochemistry_23167.jpg)
![Immunohistochemistry Cyclin B1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Cyclin_B1_AF6000_Immunohistochemistry_11792.jpg)
![Western Blot Cyclin B1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Cyclin_B1_AF6000_Western_Blot_9526.jpg)
![Simple Western Cyclin B1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Cyclin_B1_AF6000_Simple_Western_20094.jpg)
![Western Blot p27/Kip1 [p Thr157] Antibody](https://images.novusbio.com/images2/p27_AF1555_Western_Blot_5119.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")
