![Western Blot: FNBP1 Antibody [NBP2-48542] - Analysis using Anti-FNBP1 antibody NBP2-48542 (A) shows similar pattern to independent antibody NBP2-48556 (B).](http://images.novusbio.com/fullsize/FNBP1-Antibody-Western-Blot-NBP2-48542-img0007.jpg "Western Blot: FNBP1 Antibody [NBP2-48542] - Analysis using Anti-FNBP1 antibody NBP2-48542 (A) shows similar pattern to independent antibody NBP2-48556 (B).")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: KARQQAQIRHQMAEDSKADYSSILQKFNHEQHEYYHTHIPNIFQKIQEMEERRIVRMGESMKTYAEVDRQVIPIIGKCLDGIVKAAESIDQKNDSQLVIEAYKSGFE |
| Predicted Species | Mouse (93%), Rat (93%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | FNBP1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | FNBP1 |
![Immunohistochemistry-Paraffin: FNBP1 Antibody [NBP2-48542] - Staining of human testis.](http://images.novusbio.com/fullsize/FNBP1-Antibody-Immunohistochemistry-Paraffin-NBP2-48542-img0008.jpg "Immunohistochemistry-Paraffin: FNBP1 Antibody [NBP2-48542] - Staining of human testis.")
![Western Blot: FNBP1 Antibody [NBP2-48542] - Staining of human skeletal muscle shows low expression as expected.](http://images.novusbio.com/fullsize/FNBP1-Antibody-Western-Blot-NBP2-48542-img0004.jpg "Western Blot: FNBP1 Antibody [NBP2-48542] - Staining of human skeletal muscle shows low expression as expected.")
![Immunohistochemistry-Paraffin: FNBP1 Antibody [NBP2-48542] - Staining of human appendix shows strong cytoplasmic positivity in lymphoid tissue.](http://images.novusbio.com/fullsize/FNBP1-Antibody-Immunohistochemistry-Paraffin-NBP2-48542-img0002.jpg "Immunohistochemistry-Paraffin: FNBP1 Antibody [NBP2-48542] - Staining of human appendix shows strong cytoplasmic positivity in lymphoid tissue.")
![Immunohistochemistry-Paraffin: FNBP1 Antibody [NBP2-48542] - Staining of human lymph node shows high expression.](http://images.novusbio.com/fullsize/FNBP1-Antibody-Immunohistochemistry-Paraffin-NBP2-48542-img0003.jpg "Immunohistochemistry-Paraffin: FNBP1 Antibody [NBP2-48542] - Staining of human lymph node shows high expression.")
![Immunohistochemistry-Paraffin: FNBP1 Antibody [NBP2-48542] - Staining in human lymph node and skeletal muscle tissues using anti-FNBP1 antibody. Corresponding FNBP1 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/FNBP1-Antibody-Immunohistochemistry-Paraffin-NBP2-48542-img0005.jpg "Immunohistochemistry-Paraffin: FNBP1 Antibody [NBP2-48542] - Staining in human lymph node and skeletal muscle tissues using anti-FNBP1 antibody. Corresponding FNBP1 RNA-seq data are presented for the same tissues.")
![Immunohistochemistry-Paraffin: FNBP1 Antibody [NBP2-48542] - Staining of human colon, lymph node, skeletal muscle and testis using Anti-FNBP1 antibody NBP2-48542 (A) shows similar protein distribution across tissues to independent antibody NBP2-62603 (B).](http://images.novusbio.com/fullsize/FNBP1-Antibody-Immunohistochemistry-Paraffin-NBP2-48542-img0006.jpg "Immunohistochemistry-Paraffin: FNBP1 Antibody [NBP2-48542] - Staining of human colon, lymph node, skeletal muscle and testis using Anti-FNBP1 antibody NBP2-48542 (A) shows similar protein distribution across tissues to independent antibody NBP2-62603 (B).")
![Immunohistochemistry-Paraffin: FNBP1 Antibody [NBP2-48542] - Staining of human colon.](http://images.novusbio.com/fullsize/FNBP1-Antibody-Immunohistochemistry-Paraffin-NBP2-48542-img0009.jpg "Immunohistochemistry-Paraffin: FNBP1 Antibody [NBP2-48542] - Staining of human colon.")
![Western Blot Src [p Tyr419] Antibody [Unconjugated]](https://images.novusbio.com/images2/Src_AF2685_Western_Blot_5209.jpg)
![Simple Western Src [p Tyr419] Antibody [Unconjugated]](https://images.novusbio.com/images2/16327.jpg)
![Immunohistochemistry Src [p Tyr419] Antibody [Unconjugated]](https://images.novusbio.com/images2/Src_AF2685_Immunohistochemistry_7158.jpg)
![SDS-PAGE EGF [Unconjugated]](https://images.novusbio.com/images2/EGF_236-EG_234.jpg)
![Bioactivity EGF [Unconjugated]](https://images.novusbio.com/images2/EGF_236EG_1570.jpg)
![Cell Culture EGF [Unconjugated]](https://images.novusbio.com/images/236-eg_recombinant-human-egf-protein-cf-bioactivity-25202394053.jpg)
![Fas Ligand/TNFSF6 [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "Fas Ligand/TNFSF6 [Unconjugated]")
![Western Blot Angiopoietin-like Protein 2/ANGPTL2 Antibody [Unconjugated]](https://images.novusbio.com/images2/Angiopoietinlike_Protein_2_AF1444_Western_Blot_19840.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")