![Knockout Validated: FCRN/FCGRT Antibody [NBP1-89128] - Western blot shows lysates of 293 human embryonic kidney parental cell line and FCGRT knockout (KO) 293 cell line. PVDF membrane was probed with 1:500 of Rabbit Anti-Human FCGRT Polyclonal Antibody (Catalog # NBP1-89128) followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog #HAF008). Specific band was detected for FCGRT at approximately 40 kDa (as indicated) in the parental 293 cell line, but is not detectable in the knockout 293 cell line. This experiment was conducted under reducing conditions.](http://images.novusbio.com/fullsize/FCRN-FCGRT-Antibody-Knockout-Validated-NBP1-89128-img0025.jpg "Knockout Validated: FCRN/FCGRT Antibody [NBP1-89128] - Western blot shows lysates of 293 human embryonic kidney parental cell line and FCGRT knockout (KO) 293 cell line. PVDF membrane was probed with 1:500 of Rabbit Anti-Human FCGRT Polyclonal Antibody (Catalog # NBP1-89128) followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog #HAF008). Specific band was detected for FCGRT at approximately 40 kDa (as indicated) in the parental 293 cell line, but is not detectable in the knockout 293 cell line. This experiment was conducted under reducing conditions.")
| Reactivity | Hu, Pm-CmSpecies Glossary |
| Applications | WB, Simple Western, IHC, KO |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: LTFLLFSCPHRLREHLERGRGNLEWKEPPSMRLKARPSSPGFSVLTCSAFSFYPPELQLRFLRNGLAAGTGQGDFGPNSDGSFHASSSLTVKSGDEHHYCCIVQHAGLAQPLRVELESPAKS |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | FCGRT |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. In Simple Western only 10 - 15 uL of the recommended dilution is used per data point. Separated by Size-Wes, Sally Sue/Peggy Sue |
||
| Theoretical MW | 40 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
||
| Control Peptide |
|
||
| Reviewed Applications |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Simple Western Albumin Antibody (188835) [Unconjugated] - Serum](https://images.novusbio.com/images2/Albumin_MAB1455_Simple_Western_21888.jpg)
![Immunocytochemistry Albumin Antibody (188835) [Unconjugated] - Serum](https://images.novusbio.com/images2/Albumin_MAB1455_Immunocytochemistry__Immunofluorescence_17777.jpg)
![Immunohistochemistry Albumin Antibody (188835) [Unconjugated] - Serum](https://images.novusbio.com/images2/Albumin_MAB1455_Immunohistochemistry_23317.jpg)
| Images | Ratings | Applications | Species | Date | Details | ||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Enlarge |
reviewed by:
Jason Ray |
WB | Human | 10/16/2019 |
Summary
|
||||||||
Enlarge |
reviewed by:
Corey . |
IHC-P | Human | 12/04/2012 |
Summary
|
Secondary Antibodies |
Isotype Controls |
Research Areas for FCRN/FCGRT Antibody (NBP1-89128)Find related products by research area.
|
|
FcRn - neonatal Fc receptor encoded by the FCGRT gene Antibodies play an important role in the innate immune system by circulating in the bloodstream to fight off invading pathogens. IgG is the most prevalent of the five classes of antibodies (IgA, IgD, IgE, IgG, and IgM) and is the only one transmit... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
5 | |
4 | |
3 | |
2 | |
1 |
| Jason Ray 10/16/2019 |
||
| Application: | WB | |
| Species: | Human |
| Corey . 12/04/2012 |
||
| Application: | IHC-P | |
| Species: | Human |
![Western Blot: FCRN/FCGRT Antibody [NBP1-89128] - Analysis in human cell lines Caco-2 and HeLa using anti-FCGRT antibody. Corresponding FCGRT RNA-seq data are presented for the same cell lines. Loading control: anti-GAPDH.](http://images.novusbio.com/fullsize/FCRN-FCGRT-Antibody-Western-Blot-NBP1-89128-img0024.jpg "Western Blot: FCRN/FCGRT Antibody [NBP1-89128] - Analysis in human cell lines Caco-2 and HeLa using anti-FCGRT antibody. Corresponding FCGRT RNA-seq data are presented for the same cell lines. Loading control: anti-GAPDH.")
![Western Blot: FCRN/FCGRT Antibody [NBP1-89128] - Human lung epithelial A549 cells and primary bronchial epithelial cells (hAECB) lack FcgammaR (CD16, CD64, and CD32) and FcalphaR (CD89) cell surface expression as analyzed by flow cytometry (human THP1 cells as positive control). The neonatal FcR (FcRn) is expressed in both A549 cells & human THP1 cells as determined by Western blotting. Data are representative of at least two independent experiments. Absolute bacterial counts (CFUs) in human THP1 macrophages 1 h after infection with MTB preincubated with the LAM-reactive IgA1 (left) or IgG1 (right) antibody TB24PB037 or the respective isotype control antibody as indicated. Mean and SEM are indicated. Data are representative of three independent experiments. Image collected and cropped by CiteAb from the following publication (//embomolmed.embopress.org/lookup/doi/10.15252/emmm.201606330), licensed under a CC-BY license.](http://images.novusbio.com/fullsize/FCRN-FCGRT-Antibody-Western-Blot-NBP1-89128-img0029.jpg "Western Blot: FCRN/FCGRT Antibody [NBP1-89128] - Human lung epithelial A549 cells and primary bronchial epithelial cells (hAECB) lack FcgammaR (CD16, CD64, and CD32) and FcalphaR (CD89) cell surface expression as analyzed by flow cytometry (human THP1 cells as positive control). The neonatal FcR (FcRn) is expressed in both A549 cells & human THP1 cells as determined by Western blotting. Data are representative of at least two independent experiments. Absolute bacterial counts (CFUs) in human THP1 macrophages 1 h after infection with MTB preincubated with the LAM-reactive IgA1 (left) or IgG1 (right) antibody TB24PB037 or the respective isotype control antibody as indicated. Mean and SEM are indicated. Data are representative of three independent experiments. Image collected and cropped by CiteAb from the following publication (//embomolmed.embopress.org/lookup/doi/10.15252/emmm.201606330), licensed under a CC-BY license.")
![Immunohistochemistry-Paraffin: FCRN/FCGRT Antibody [NBP1-89128] - Staining in human placental Hoffbauer cells at a 1:65 dilution. Image from a verified customer review.](http://images.novusbio.com/fullsize/FCRN-FCGRT-Antibody-Immunohistochemistry-Paraffin-NBP1-89128-img0028.jpg "Immunohistochemistry-Paraffin: FCRN/FCGRT Antibody [NBP1-89128] - Staining in human placental Hoffbauer cells at a 1:65 dilution. Image from a verified customer review.")
![Western Blot: FCRN/FCGRT Antibody [NBP1-89128] - Analysis in control (vector only transfected HEK293T lysate) and FCGRT over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).](http://images.novusbio.com/fullsize/FCRN-FCGRT-Antibody-Western-Blot-NBP1-89128-img0026.jpg "Western Blot: FCRN/FCGRT Antibody [NBP1-89128] - Analysis in control (vector only transfected HEK293T lysate) and FCGRT over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).")
![Immunohistochemistry-Paraffin: FCRN/FCGRT Antibody [NBP1-89128] - Immunohistochemical staining of human liver shows moderate to strong cytoplasmic positivity in Kupffer cells.](http://images.novusbio.com/fullsize/FCRN-FCGRT-Antibody-Immunohistochemistry-Paraffin-NBP1-89128-img0011.jpg "Immunohistochemistry-Paraffin: FCRN/FCGRT Antibody [NBP1-89128] - Immunohistochemical staining of human liver shows moderate to strong cytoplasmic positivity in Kupffer cells.")
![Immunohistochemistry-Paraffin: FCRN/FCGRT Antibody [NBP1-89128] - Immunohistochemical staining of human cerebellum shows no positivity in neuronal cells as expected.](http://images.novusbio.com/fullsize/FCRN-FCGRT-Antibody-Immunohistochemistry-Paraffin-NBP1-89128-img0012.jpg "Immunohistochemistry-Paraffin: FCRN/FCGRT Antibody [NBP1-89128] - Immunohistochemical staining of human cerebellum shows no positivity in neuronal cells as expected.")
![Immunohistochemistry-Paraffin: FCRN/FCGRT Antibody [NBP1-89128] - Staining of human placenta shows moderate to strong cytoplasmic positivity in Hofbauer cells.](http://images.novusbio.com/fullsize/FCRN-FCGRT-Antibody-Immunohistochemistry-Paraffin-NBP1-89128-img0015.jpg "Immunohistochemistry-Paraffin: FCRN/FCGRT Antibody [NBP1-89128] - Staining of human placenta shows moderate to strong cytoplasmic positivity in Hofbauer cells.")
![Immunohistochemistry-Paraffin: FCRN/FCGRT Antibody [NBP1-89128] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.](http://images.novusbio.com/fullsize/FCRN-FCGRT-Antibody-Immunohistochemistry-Paraffin-NBP1-89128-img0027.jpg "Immunohistochemistry-Paraffin: FCRN/FCGRT Antibody [NBP1-89128] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.")
![Simple Western: FCRN/FCGRT Antibody [NBP1-89128] - Simple Western lane view shows a specific band for FCGRT in 0.2 mg/ml of h. Liver (left), HepG2 (middle) and THP-1 (right) lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.](http://images.novusbio.com/fullsize/FCRN-FCGRT-Antibody-Simple-Western-NBP1-89128-img0008.jpg "Simple Western: FCRN/FCGRT Antibody [NBP1-89128] - Simple Western lane view shows a specific band for FCGRT in 0.2 mg/ml of h. Liver (left), HepG2 (middle) and THP-1 (right) lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.")
![Simple Western: FCRN/FCGRT Antibody [NBP1-89128] - Electropherogram image(s) of corresponding Simple Western lane view. FCRN/FCGRT antibody was used at 1:20 dilution on h. Liver, HepG2, and THP-1 lysate(s).](http://images.novusbio.com/fullsize/FCRN-FCGRT-Antibody-Simple-Western-NBP1-89128-img0010.jpg "Simple Western: FCRN/FCGRT Antibody [NBP1-89128] - Electropherogram image(s) of corresponding Simple Western lane view. FCRN/FCGRT antibody was used at 1:20 dilution on h. Liver, HepG2, and THP-1 lysate(s).")
![Immunocytochemistry/ Immunofluorescence: FCRN/FCGRT Antibody [NBP1-89128] - FcRn localization in air–liquid interface culture of human nasal epithelial cells on day 21. Cells were co-immunolabeled for FcRn (green) & (A) a basal cell marker, cytokeratin-14 (red), or (B) a goblet cell marker, mucin-5AC (red), or (C) a ciliated cell marker, acetylated alpha -tubulin (red); & imaged by confocal microscopy. White scale bars represent 5 μm. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/30893823), licensed under a CC-BY license. Not internally tested by Novus Biologicals.](http://images.novusbio.com/fullsize/nbp1-89128_rabbit-polyclonal-fcrn-fcgrt-antibody-310202415371915.jpg "Immunocytochemistry/ Immunofluorescence: FCRN/FCGRT Antibody [NBP1-89128] - FcRn localization in air–liquid interface culture of human nasal epithelial cells on day 21. Cells were co-immunolabeled for FcRn (green) & (A) a basal cell marker, cytokeratin-14 (red), or (B) a goblet cell marker, mucin-5AC (red), or (C) a ciliated cell marker, acetylated alpha -tubulin (red); & imaged by confocal microscopy. White scale bars represent 5 μm. Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/30893823), licensed under a CC-BY license. Not internally tested by Novus Biologicals.")
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![Bioactivity CTLA-4 [Unconjugated]](https://images.novusbio.com/images2/CTLA4_7268CT_2293.jpg)
![SDS-PAGE Fc gamma RIIIA/CD16a [Unconjugated]](https://images.novusbio.com/images2/Fc_gamma_RIIIA_4325-FC_411.jpg)
![Binding Activity Fc gamma RIIIA/CD16a [Unconjugated]](https://images.novusbio.com/images2/Fc_gamma_RIIIA_4325-FC_491.jpg)
![SEC-MALS Fc gamma RIIIA/CD16a [Unconjugated]](https://images.novusbio.com/images/4325-fc_recombinant-human-fc-gamma-riiia-cd16a-protein-cf-sec-mals-2842023172947.jpg)
![Control Mouse IgG3 Isotype Control (133316) [Unconjugated]](https://images.novusbio.com/images2/IgG3_MAB007_Control_19774.jpg)
![N/A Erythropoietin/EPO [HRP]](https://images.novusbio.com/images2/DATA_Erythropoietin_MEP00_ELISA_970.jpg)
![N/A Erythropoietin/EPO [HRP]](https://images.novusbio.com/images2/Erythropoietin_MEP00_ELISA_421.jpg)
![Flow Cytometry CD1b Antibody (737249) [Unconjugated]](https://images.novusbio.com/images2/CD1b_MAB7446_Flow_Cytometry_12185.jpg)
![Binding Activity Fc gamma RI/CD64 [Unconjugated]](https://images.novusbio.com/images2/Fc_gamma_RI_1257FC_2060.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")
