![Western Blot: DNA polymerase delta p50 Antibody [NBP1-90925] - Analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-POLD2 antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.](http://images.novusbio.com/fullsize/DNA-polymerase-delta-p50-Antibody-Western-Blot-NBP1-90925-img0012.jpg "Western Blot: DNA polymerase delta p50 Antibody [NBP1-90925] - Analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-POLD2 antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ICC/IF, IHC, KD |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: PRSKYIHPDDELVLEDELQRIKLKGTIDVSKLVTGTVLAVFGSVRDDGKFLVEDYCFADLAPQKPAPPLDTDRFVLLVSGLGLGGGGGESLLGTQLLVDVVTGQLGDEGEQC |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | POLD2 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for DNA polymerase delta p50 Antibody (NBP1-90925)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | POLD2 |
![Western Blot: DNA polymerase delta p50 Antibody [NBP1-90925] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.](http://images.novusbio.com/fullsize/DNA-polymerase-delta-p50-Antibody-Western-Blot-NBP1-90925-img0017.jpg "Western Blot: DNA polymerase delta p50 Antibody [NBP1-90925] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.")
![Immunocytochemistry/Immunofluorescence: DNA polymerase delta p50 Antibody [NBP1-90925] - Staining of human cell line U-2 OS shows localization to nucleoplasm. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/DNA-polymerase-delta-p50-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-90925-img0010.jpg "Immunocytochemistry/Immunofluorescence: DNA polymerase delta p50 Antibody [NBP1-90925] - Staining of human cell line U-2 OS shows localization to nucleoplasm. Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: DNA polymerase delta p50 Antibody [NBP1-90925] - Staining of human Fallopian tube shows moderate nuclear positivity in glandular cells.](http://images.novusbio.com/fullsize/DNA-polymerase-delta-p50-Antibody-Immunohistochemistry-Paraffin-NBP1-90925-img0018.jpg "Immunohistochemistry-Paraffin: DNA polymerase delta p50 Antibody [NBP1-90925] - Staining of human Fallopian tube shows moderate nuclear positivity in glandular cells.")
![Western Blot: DNA polymerase delta p50 Antibody [NBP1-90925] - Analysis in human cell line SK-BR-3.](http://images.novusbio.com/fullsize/DNA-polymerase-delta-p50-Antibody-Western-Blot-NBP1-90925-img0011.jpg "Western Blot: DNA polymerase delta p50 Antibody [NBP1-90925] - Analysis in human cell line SK-BR-3.")
![Immunohistochemistry-Paraffin: DNA polymerase delta p50 Antibody [NBP1-90925] - Staining of human skin shows moderate to strong nuclear positivity in squamous epithelial cells.](http://images.novusbio.com/fullsize/DNA-polymerase-delta-p50-Antibody-Immunohistochemistry-Paraffin-NBP1-90925-img0013.jpg "Immunohistochemistry-Paraffin: DNA polymerase delta p50 Antibody [NBP1-90925] - Staining of human skin shows moderate to strong nuclear positivity in squamous epithelial cells.")
![Immunohistochemistry-Paraffin: DNA polymerase delta p50 Antibody [NBP1-90925] - Staining of human pancreas shows very weak positivity in exocrine glandular cells.](http://images.novusbio.com/fullsize/DNA-polymerase-delta-p50-Antibody-Immunohistochemistry-Paraffin-NBP1-90925-img0014.jpg "Immunohistochemistry-Paraffin: DNA polymerase delta p50 Antibody [NBP1-90925] - Staining of human pancreas shows very weak positivity in exocrine glandular cells.")
![Immunohistochemistry-Paraffin: DNA polymerase delta p50 Antibody [NBP1-90925] - Staining of human testis shows moderate to strong nuclear positivity in cells in seminiferous ducts.](http://images.novusbio.com/fullsize/DNA-polymerase-delta-p50-Antibody-Immunohistochemistry-Paraffin-NBP1-90925-img0016.jpg "Immunohistochemistry-Paraffin: DNA polymerase delta p50 Antibody [NBP1-90925] - Staining of human testis shows moderate to strong nuclear positivity in cells in seminiferous ducts.")
![Western Blot Brg1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Brg1_AF5738_Western_Blot_5829.jpg)
![Immunocytochemistry Brg1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Brg1_AF5738_Immunocytochemistry_11663.jpg)
![Immunocytochemistry Brg1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Brg1_AF5738_Immunocytochemistry_11664.jpg)
![Agonist Activity CD40/TNFRSF5 Antibody [Unconjugated]](https://images.novusbio.com/images2/CD40_AF632_Functional_Assay_15457.jpg)
![Western Blot CD40/TNFRSF5 Antibody [Unconjugated]](https://images.novusbio.com/images2/CD40_AF632_Western_Blot_20204.jpg)
![Simple Western CD40/TNFRSF5 Antibody [Unconjugated]](https://images.novusbio.com/images2/af632_human-cd40-tnfrsf5-affinity-purified-polyclonal-ab-simple-western-58202111562.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")