Home » Dlx1 » Dlx1 Proteins » Dlx1 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

Dlx1 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for Dlx1 Protein (NBP1-91837PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

Dlx1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human DLX1.

Source: E. coli

Amino Acid Sequence: MTMTTMPESLNSPVSGKAVFMEFGPPNQQMSPSPMSHGHYSMHCLHSAGHSQPDGAYSSASSFSRPLGYPYVNSVS

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
DLX1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-91837.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Dlx1 Recombinant Protein Antigen

  • distal-less homeo box 1
  • distal-less homeobox 1
  • homeobox protein DLX-1

Background

The Dlx1 gene encodes a member of a homeobox transcription factor gene family similiar to the Drosophila distal-less gene. The encoded protein is localized to the nucleus where it may function as a transcriptional regulator of signals from multiple TGF-{beta}

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

DLX2 Antibody
(HL1942) - Azide and ...
NBP3-25440
Western Blot DLX2 Antibody (HL1942) - Azide and BSA Free
Immunocytochemistry/ Immunofluorescence DLX2 Antibody (HL1942) - Azide and BSA Free
Western Blot DLX2 Antibody (HL1942) - Azide and BSA Free
Species: Hu, Rt
Applications: ICC/IF, WB
DLX5 Antibody
NBP1-85793
Immunocytochemistry/ Immunofluorescence DLX5 Antibody
Immunohistochemistry-Paraffin DLX5 Antibody
Immunohistochemistry-Paraffin DLX5 Antibody
(3 Publications)
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Dlx6 Antibody
NBP1-85929
Immunohistochemistry-Paraffin Dlx6 Antibody
(2 Publications)
Species: Hu
Applications: ChIP, IHC, IHC-P, WB
ASCL1/Mash1
Antibody [Unconjugate
AF2567
Immunohistochemistry ASCL1/Mash1 Antibody [Unconjugated]
(2 Publications)
Species: Mu
Applications: IHC, WB
BP1 Antibody
NB100-481
Western Blot BP1 Antibody
Western Blot BP1 Antibody
Immunohistochemistry-Frozen BP1 Antibody
(1 Review)
(7 Publications)
Species: Hu
Applications: ChIP, IHC, IHC-Fr, IHC-P, IP, WB
MSX1 Antibody
[Unconjugated]
AF5045
Western Blot MSX1 Antibody [Unconjugated]
Immunohistochemistry MSX1 Antibody [Unconjugated]
Western Blot MSX1 Antibody [Unconjugated]
(11 Publications)
Species: Hu, Mu
Applications: IHC, WB
BMP-4
[Unconjugated]
314-BP
SDS-PAGE BMP-4 [Unconjugated]
Bioactivity BMP-4 [Unconjugated]
(522 Publications)
Species: Hu
Applications: BA, BA
DLX3 Antibody
NBP2-24646
Immunohistochemistry-Paraffin DLX3 Antibody
Western Blot DLX3 Antibody
Species: Bv, Ca, Eq, Hu, Mu, Pm
Applications: IHC, IHC-P, WB
Calretinin Antibody
NBP1-88220
Immunocytochemistry/ Immunofluorescence Calretinin Antibody
Western Blot Calretinin Antibody
Immunohistochemistry-Paraffin Calretinin Antibody
(1 Review)
(1 Publication)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
FGF-8
[Unconjugated]
423-F8
SDS-PAGE FGF-8 [Unconjugated]
Bioactivity FGF-8 [Unconjugated]
Cell Culture FGF-8 [Unconjugated]
(1 Review)
(63 Publications)
Species: Hu, Mu
Applications: BA
TTF-1 / NKX2-1
Antibody (8G7G3/1 + N ...
NBP2-44501
Immunohistochemistry TTF-1 / NKX2-1 Antibody (8G7G3/1 + NX2.1/690)
Immunohistochemistry-Paraffin TTF-1 / NKX2-1 Antibody (8G7G3/1 + NX2.1/690)
Immunohistochemistry-Paraffin TTF-1 / NKX2-1 Antibody (8G7G3/1 + NX2.1/690)
(1 Review)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IF, IHC, IHC-P
Pax6 Antibody
[Unconjugated]
AF8150
Simple Western Pax6 Antibody [Unconjugated]
Immunocytochemistry Pax6 Antibody [Unconjugated]
Western Blot Pax6 Antibody [Unconjugated]
(16 Publications)
Species: Hu
Applications: ICC, ICFlow, Simple Western, WB
PITX2 Antibody
[Unconjugated]
AF7388
Immunohistochemistry PITX2 Antibody [Unconjugated]
(8 Publications)
Species: Hu
Applications: IHC
GAD1/GAD67
Antibody [Unconjugate
AF2086
Immunohistochemistry GAD1/GAD67 Antibody [Unconjugated]
Western Blot GAD1/GAD67 Antibody [Unconjugated]
Simple Western GAD1/GAD67 Antibody [Unconjugated]
(13 Publications)
Species: Hu, Mu, Rt
Applications: IHC, Simple Western, WB
Neuropeptide Y
Antibody
NBP1-46535
Immunohistochemistry Neuropeptide Y Antibody
Immunocytochemistry/ Immunofluorescence Neuropeptide Y Antibody
(20 Publications)
Species: Hu, Mu, Rb, Rt, Xp
Applications: ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, WB
ARX Antibody
AF7068
Western Blot ARX Antibody
Immunocytochemistry ARX Antibody
Immunohistochemistry ARX Antibody
(11 Publications)
Species: Hu
Applications: ICC, IHC, WB
Somatostatin
Antibody (7G5) - BSA
NBP2-37447
Immunofluorescence Somatostatin Antibody (7G5) - BSA Free
Immunohistochemistry-Paraffin Somatostatin Antibody (7G5) - BSA Free
ELISA Somatostatin Antibody (7G5) - BSA Free
(1 Review)
(3 Publications)
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P
ELSPBP1 Antibody
NBP2-13957
Western Blot ELSPBP1 Antibody
Immunohistochemistry-Paraffin ELSPBP1 Antibody
Immunohistochemistry-Paraffin ELSPBP1 Antibody
Species: Hu
Applications: IHC, IHC-P, WB
EVX2 Antibody
NBP1-90973
Immunohistochemistry-Paraffin EVX2 Antibody
Species: Hu
Applications: IHC, IHC-P
Dlx1 Recombinant
Protein Antigen
NBP1-91837PEP
Dlx1 Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for Dlx1 Protein (NBP1-91837PEP) (0)

There are no publications for Dlx1 Protein (NBP1-91837PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Dlx1 Protein (NBP1-91837PEP) (0)

There are no reviews for Dlx1 Protein (NBP1-91837PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Dlx1 Protein (NBP1-91837PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Dlx1 Products

Research Areas for Dlx1 Protein (NBP1-91837PEP)

Find related products by research area.

Blogs on Dlx1

There are no specific blogs for Dlx1, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

1 μg/lane of Recombinant Human/Mouse FGF-8b was resolved with SDS-PAGE under reducing (R) conditions and visualized by silver staining, showing a single band at 23 kDa.
FGF-8 [Unconjugated]
423-F8-025

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Dlx1 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol DLX1