![Immunohistochemistry-Paraffin: ELSPBP1 Antibody [NBP2-13957] - Analysis in human epididymis and prostate tissues. Corresponding ELSPBP1 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/ELSPBP1-Antibody-Immunohistochemistry-Paraffin-NBP2-13957-img0007.jpg "Immunohistochemistry-Paraffin: ELSPBP1 Antibody [NBP2-13957] - Analysis in human epididymis and prostate tissues. Corresponding ELSPBP1 RNA-seq data are presented for the same tissues.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the amino acids: SCISQGSFLGSLWWSVTSVFDEKQQWKFCETNEYGGNSLRKPCIFPSIYRNNVVSDCMEDESNKLWCPT |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | ELSPBP1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for ELSPBP1 Antibody (NBP2-13957)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | ELSPBP1 |
![Immunohistochemistry-Paraffin: ELSPBP1 Antibody [NBP2-13957] - Staining of human cerebral cortex, epididymis, prostate and testis using Anti-ELSPBP1 antibody NBP2-13957 (A) shows similar protein distribution across tissues to independent antibody NBP2-13958 (B).](http://images.novusbio.com/fullsize/ELSPBP1-Antibody-Immunohistochemistry-Paraffin-NBP2-13957-img0009.jpg "Immunohistochemistry-Paraffin: ELSPBP1 Antibody [NBP2-13957] - Staining of human cerebral cortex, epididymis, prostate and testis using Anti-ELSPBP1 antibody NBP2-13957 (A) shows similar protein distribution across tissues to independent antibody NBP2-13958 (B).")
![Western Blot: ELSPBP1 Antibody [NBP2-13957] - Analysis in control (vector only transfected HEK293T lysate) and ELSPBP1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).](http://images.novusbio.com/fullsize/ELSPBP1-Antibody-Western-Blot-NBP2-13957-img0006.jpg "Western Blot: ELSPBP1 Antibody [NBP2-13957] - Analysis in control (vector only transfected HEK293T lysate) and ELSPBP1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).")
![Immunohistochemistry-Paraffin: ELSPBP1 Antibody [NBP2-13957] - Staining of human testis shows moderate cytoplasmic positivity in Leydig cells.](http://images.novusbio.com/fullsize/ELSPBP1-Antibody-Immunohistochemistry-Paraffin-NBP2-13957-img0012.jpg "Immunohistochemistry-Paraffin: ELSPBP1 Antibody [NBP2-13957] - Staining of human testis shows moderate cytoplasmic positivity in Leydig cells.")
![Immunohistochemistry-Paraffin: ELSPBP1 Antibody [NBP2-13957] - Staining of human cerebral cortex shows no positivity in neurons as expected.](http://images.novusbio.com/fullsize/ELSPBP1-Antibody-Immunohistochemistry-Paraffin-NBP2-13957-img0008.jpg "Immunohistochemistry-Paraffin: ELSPBP1 Antibody [NBP2-13957] - Staining of human cerebral cortex shows no positivity in neurons as expected.")
![Immunohistochemistry-Paraffin: ELSPBP1 Antibody [NBP2-13957] - Staining of human epididymis shows moderate cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/ELSPBP1-Antibody-Immunohistochemistry-Paraffin-NBP2-13957-img0010.jpg "Immunohistochemistry-Paraffin: ELSPBP1 Antibody [NBP2-13957] - Staining of human epididymis shows moderate cytoplasmic positivity in glandular cells.")
![Immunohistochemistry-Paraffin: ELSPBP1 Antibody [NBP2-13957] - Staining of human prostate shows no positivity in glandular cells as expected.](http://images.novusbio.com/fullsize/ELSPBP1-Antibody-Immunohistochemistry-Paraffin-NBP2-13957-img0011.jpg "Immunohistochemistry-Paraffin: ELSPBP1 Antibody [NBP2-13957] - Staining of human prostate shows no positivity in glandular cells as expected.")
![Western Blot TCF-3/E2A Antibody (826927) [Unconjugated]](https://images.novusbio.com/images2/TCF3_MAB7650_Western_Blot_12841.jpg)
![Immunohistochemistry TCF-3/E2A Antibody (826927) [Unconjugated]](https://images.novusbio.com/images2/TCF3_MAB7650_Immunohistochemistry_12859.jpg)
![Bioactivity Sonic Hedgehog/Shh [Unconjugated]](https://images.novusbio.com/images2/Sonic_Hedgehog_464SH_2840.jpg)
![SDS-PAGE Sonic Hedgehog/Shh [Unconjugated]](https://images.novusbio.com/images2/Sonic_Hedgehog_464-SH_341.jpg)
![SEC-MALS Sonic Hedgehog/Shh [Unconjugated]](https://images.novusbio.com/images/464-sh_recombinant-mouse-sonic-hedgehog-shh-c25ii-n-terminus-sec-mals-642023224324.jpg)
![N/A BDNF [HRP]](https://images.novusbio.com/images2/DATA_BDNF_DBD00_ELISA_587.jpg)
![N/A BDNF [HRP]](https://images.novusbio.com/images2/DATA_BDNF_DBD00_ELISA_588.jpg)
![N/A BDNF [HRP]](https://images.novusbio.com/images2/BDNF_DBD00_ELISA_36.jpg)
![Western Blot ID1 Antibody [Unconjugated]](https://images.novusbio.com/images2/ID1_AF4377_Western_Blot_5453.jpg)
![Immunocytochemistry ID1 Antibody [Unconjugated]](https://images.novusbio.com/images2/ID1_AF4377_Immunocytochemistry_12849.jpg)
![Simple Western ID1 Antibody [Unconjugated]](https://images.novusbio.com/images2/af4377_human-mouse-id1-affinity-purified-polyclonal-ab-simple-western-482021152036.jpg)
![SDS-PAGE BMP-4 [Unconjugated]](https://images.novusbio.com/images2/BMP-4_314-BP_100.jpg)
![Bioactivity BMP-4 [Unconjugated]](https://images.novusbio.com/images2/314-bp_recombinant-human-bmp-4-protein-1882021123744.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")