![Immunohistochemistry-Paraffin: Cytokeratin 7 Antibody [NBP1-88080] - Staining in human placenta and skeletal muscle tissues . Corresponding KRT7 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/Cytokeratin-7-Antibody-Immunohistochemistry-Paraffin-NBP1-88080-img0021.jpg "Immunohistochemistry-Paraffin: Cytokeratin 7 Antibody [NBP1-88080] - Staining in human placenta and skeletal muscle tissues . Corresponding KRT7 RNA-seq data are presented for the same tissues.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, Simple Western, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: RQEESEQIKTLNNKFASFIDKVRFLEQQNKLLETKWTLLQEQKSAKSSRLPDIFEAQIAGLRGQLEALQVDGGRLEAELRSMQDVVEDFKNKYEDEINRRTAAENEFVVLKKDVD |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | KRT7 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. In Simple Western only 10 - 15 uL of the recommended dilution is used per data point. Separated by Size-Wes, Sally Sue/Peggy Sue. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Choline Kinase beta [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "Choline Kinase beta [Unconjugated]")
Secondary Antibodies |
Isotype Controls |
Research Areas for Cytokeratin 7 Antibody (NBP1-88080)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Western Blot: Cytokeratin 7 Antibody [NBP1-88080] - Analysis in human cell lines A-549 and HEK293 using Anti-KRT7 antibody. Corresponding KRT7 RNA-seq data are presented for the same cell lines. Loading control: Anti-COX4I1.](http://images.novusbio.com/fullsize/Cytokeratin-7-Antibody-Western-Blot-NBP1-88080-img0010.jpg "Western Blot: Cytokeratin 7 Antibody [NBP1-88080] - Analysis in human cell lines A-549 and HEK293 using Anti-KRT7 antibody. Corresponding KRT7 RNA-seq data are presented for the same cell lines. Loading control: Anti-COX4I1.")
![Western Blot: Cytokeratin 7 Antibody [NBP1-88080] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.](http://images.novusbio.com/fullsize/Cytokeratin-7-Antibody-Western-Blot-NBP1-88080-img0009.jpg "Western Blot: Cytokeratin 7 Antibody [NBP1-88080] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.")
![Immunohistochemistry-Paraffin: Cytokeratin 7 Antibody [NBP1-88080] - Staining of human breast shows strong membranous positivity in glandular cells.](http://images.novusbio.com/fullsize/Cytokeratin-7-Antibody-Immunohistochemistry-Paraffin-NBP1-88080-img0017.jpg "Immunohistochemistry-Paraffin: Cytokeratin 7 Antibody [NBP1-88080] - Staining of human breast shows strong membranous positivity in glandular cells.")
![Immunohistochemistry-Paraffin: Cytokeratin 7 Antibody [NBP1-88080] - Staining of human lung shows moderate membranous positivity in pneumocytes.](http://images.novusbio.com/fullsize/Cytokeratin-7-Antibody-Immunohistochemistry-Paraffin-NBP1-88080-img0018.jpg "Immunohistochemistry-Paraffin: Cytokeratin 7 Antibody [NBP1-88080] - Staining of human lung shows moderate membranous positivity in pneumocytes.")
![Immunohistochemistry-Paraffin: Cytokeratin 7 Antibody [NBP1-88080] - Staining of human placenta shows strong membranous positivity in trophoblastic cells.](http://images.novusbio.com/fullsize/Cytokeratin-7-Antibody-Immunohistochemistry-Paraffin-NBP1-88080-img0019.jpg "Immunohistochemistry-Paraffin: Cytokeratin 7 Antibody [NBP1-88080] - Staining of human placenta shows strong membranous positivity in trophoblastic cells.")
![Immunohistochemistry-Paraffin: Cytokeratin 7 Antibody [NBP1-88080] - Staining of human skeletal muscle shows no positivity in myocytes as expected.](http://images.novusbio.com/fullsize/Cytokeratin-7-Antibody-Immunohistochemistry-Paraffin-NBP1-88080-img0020.jpg "Immunohistochemistry-Paraffin: Cytokeratin 7 Antibody [NBP1-88080] - Staining of human skeletal muscle shows no positivity in myocytes as expected.")
![Simple Western: Cytokeratin 7 Antibody [NBP1-88080] - Simple Western lane view shows a specific band for KRT7 in 0.2 mg/ml of Tonsil (left), RT-4 (right) lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.](http://images.novusbio.com/fullsize/Cytokeratin-7-Antibody-Simple-Western-NBP1-88080-img0006.jpg "Simple Western: Cytokeratin 7 Antibody [NBP1-88080] - Simple Western lane view shows a specific band for KRT7 in 0.2 mg/ml of Tonsil (left), RT-4 (right) lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.")
![Simple Western: Cytokeratin 7 Antibody [NBP1-88080] - Electropherogram image(s) of corresponding Simple Western lane view. Cytokeratin 7 antibody was used at 1:50 dilution on Tonsil and RT-4 lysate(s).](http://images.novusbio.com/fullsize/Cytokeratin-7-Antibody-Simple-Western-NBP1-88080-img0007.jpg "Simple Western: Cytokeratin 7 Antibody [NBP1-88080] - Electropherogram image(s) of corresponding Simple Western lane view. Cytokeratin 7 antibody was used at 1:50 dilution on Tonsil and RT-4 lysate(s).")
![Immunohistochemistry Neprilysin/CD10 Antibody [Unconjugated]](https://images.novusbio.com/images2/Neprilysin_AF1126_Immunohistochemistry_6679.jpg)
![Western Blot Neprilysin/CD10 Antibody [Unconjugated]](https://images.novusbio.com/images/af1126_mouse-neprilysin-affinity-purified-polyclonal-ab-8220249505976.jpg)
![Western Blot Neprilysin/CD10 Antibody [Unconjugated]](https://images.novusbio.com/images/af1126_mouse-neprilysin-affinity-purified-polyclonal-ab-44202415433122.jpg)
![Immunohistochemistry CEACAM7 Antibody [Unconjugated]](https://images.novusbio.com/images2/CEACAM7_AF4478_Immunohistochemistry_20616.jpg)
![Western Blot CEACAM7 Antibody [Unconjugated]](https://images.novusbio.com/images2/CEACAM-7_AF4478_Western_Blot_5475.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")