![Western Blot: Cytochrome P450 2C8 Antibody [NBP1-88054] - Analysis using Anti-CYP2C8 antibody NBP1-88054 (A) shows similar pattern to independent antibody NBP1-88055 (B).](http://images.novusbio.com/fullsize/Cytochrome-P450-2C8-Antibody-Western-Blot-NBP1-88054-img0009.jpg "Western Blot: Cytochrome P450 2C8 Antibody [NBP1-88054] - Analysis using Anti-CYP2C8 antibody NBP1-88054 (A) shows similar pattern to independent antibody NBP1-88055 (B).")
| Reactivity | HuSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: ICSVVFQKRFDYKDQNFLTLMKRFNENFRILNSPWIQVCNNFPLLIDCFPGTHNKVLKNVALTRSYIREKVKEHQASLDVNNPRDFIDCFLIKMEQEKDNQKSEFNIENLVGTVADLFVAG |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | CYP2C8 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for Cytochrome P450 2C8 Antibody (NBP1-88054)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | CYP2C8 |
![Immunohistochemistry-Paraffin: Cytochrome P450 2C8 Antibody [NBP1-88054] - Staining of human cerebellum, fallopian tube, liver and skin using Anti-CYP2C8 antibody (A) NBP1-88054 shows similar protein distribution across tissues to independent antibody NBP1-88055 (B).](http://images.novusbio.com/fullsize/Cytochrome-P450-2C8-Antibody-Immunohistochemistry-Paraffin-NBP1-88054-img0018.jpg "Immunohistochemistry-Paraffin: Cytochrome P450 2C8 Antibody [NBP1-88054] - Staining of human cerebellum, fallopian tube, liver and skin using Anti-CYP2C8 antibody (A) NBP1-88054 shows similar protein distribution across tissues to independent antibody NBP1-88055 (B).")
![Immunohistochemistry-Paraffin: Cytochrome P450 2C8 Antibody [NBP1-88054] - Analysis in human liver and skin tissues. Corresponding CYP2C8 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/Cytochrome-P450-2C8-Antibody-Immunohistochemistry-Paraffin-NBP1-88054-img0013.jpg "Immunohistochemistry-Paraffin: Cytochrome P450 2C8 Antibody [NBP1-88054] - Analysis in human liver and skin tissues. Corresponding CYP2C8 RNA-seq data are presented for the same tissues.")
![Immunohistochemistry-Paraffin: Cytochrome P450 2C8 Antibody [NBP1-88054] - Staining of human cerebellum shows no positivity in Purkinje cells as expected.](http://images.novusbio.com/fullsize/Cytochrome-P450-2C8-Antibody-Immunohistochemistry-Paraffin-NBP1-88054-img0014.jpg "Immunohistochemistry-Paraffin: Cytochrome P450 2C8 Antibody [NBP1-88054] - Staining of human cerebellum shows no positivity in Purkinje cells as expected.")
![Immunohistochemistry-Paraffin: Cytochrome P450 2C8 Antibody [NBP1-88054] - Staining of human Fallopian tube shows no positivity in glandular cells as expected.](http://images.novusbio.com/fullsize/Cytochrome-P450-2C8-Antibody-Immunohistochemistry-Paraffin-NBP1-88054-img0015.jpg "Immunohistochemistry-Paraffin: Cytochrome P450 2C8 Antibody [NBP1-88054] - Staining of human Fallopian tube shows no positivity in glandular cells as expected.")
![Immunohistochemistry-Paraffin: Cytochrome P450 2C8 Antibody [NBP1-88054] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.](http://images.novusbio.com/fullsize/Cytochrome-P450-2C8-Antibody-Immunohistochemistry-Paraffin-NBP1-88054-img0016.jpg "Immunohistochemistry-Paraffin: Cytochrome P450 2C8 Antibody [NBP1-88054] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.")
![Immunohistochemistry-Paraffin: Cytochrome P450 2C8 Antibody [NBP1-88054] - Staining of human skin shows no positivity in squamous epithelial cells as expected.](http://images.novusbio.com/fullsize/Cytochrome-P450-2C8-Antibody-Immunohistochemistry-Paraffin-NBP1-88054-img0017.jpg "Immunohistochemistry-Paraffin: Cytochrome P450 2C8 Antibody [NBP1-88054] - Staining of human skin shows no positivity in squamous epithelial cells as expected.")
![PXR/NR1I2 Antibody (H4417) [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "PXR/NR1I2 Antibody (H4417) [Unconjugated]")
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")