Home » Cyclophilin A » Cyclophilin A Proteins » Cyclophilin A Recombinant Protein Antigen

Cyclophilin A Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for Cyclophilin A Recombinant Protein Antigen (NBP2-46850PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals offers 100% Guarantee

Cyclophilin A Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PPIA.

Source: E. coli

Amino Acid Sequence: FGKVKERVNIVEAMEHFGYRNSKTSKKITIADCG

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
PPIA
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-46850.It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com
Theoretical MW
21 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Cyclophilin A Recombinant Protein Antigen

  • Cyclophilin A
  • Cyclosporin A-binding protein
  • CYPA
  • CYPAMGC12404
  • CYPH
  • EC 5.2.1.8
  • MGC117158
  • MGC23397
  • peptidyl-prolyl cis-trans isomerase A
  • peptidylprolyl isomerase A (cyclophilin A)
  • PPIA
  • PPIase A
  • Rotamase A
  • Rotamase
  • T cell cyclophilin

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

Cyclophilin A
Antibody
NBP1-30993
Western Blot Cyclophilin A Antibody
Western Blot Cyclophilin A Antibody
Western Blot Cyclophilin A Antibody
(2 Publications)
Species: Ha, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
PPIL1 Antibody
(OTI2D1)
NBP2-45382
Western Blot PPIL1 Antibody (OTI2D1)
Immunohistochemistry PPIL1 Antibody (OTI2D1)
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB

TACI/TNFRSF13B/CVID An
NB100-56516
Western Blot TACI/TNFRSF13B/CVID Antibody
(7 Publications)
Species: Hu, Mu
Applications: IHC, IHC-P, WB
FKBP52/FKBP4
Antibody (5C11)
H00002288-M01
ELISA FKBP52/FKBP4 Antibody (5C11)
Western Blot FKBP52/FKBP4 Antibody (5C11)
Immunohistochemistry-Paraffin FKBP52/FKBP4 Antibody (5C11)
(2 Publications)
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, IP, WB
FKBP12 Antibody
(422513)
MAB3777
Western Blot FKBP12 Antibody (422513)
(1 Review)
(4 Publications)
Species: Hu, Mu, Rt
Applications: WB
FKBP51/FKBP5
Antibody [Unconjugate
AF4094
Western Blot FKBP51/FKBP5 Antibody [Unconjugated]
Simple Western FKBP51/FKBP5 Antibody [Unconjugated]
Immunohistochemistry FKBP51/FKBP5 Antibody [Unconjugated]
(9 Publications)
Species: Hu, Mu, Rt
Applications: IHC, KO, Simple Western, WB
FKBP13/FKBP2
Antibody (422617)
MAB4356
Western Blot FKBP13/FKBP2 Antibody (422617)
(3 Publications)
Species: Hu, Mu, Rt
Applications: WB
GAPDH Antibody
(1D4)
NB300-221
Western Blot GAPDH Antibody (1D4)
Immunocytochemistry/ Immunofluorescence GAPDH Antibody (1D4)
Immunocytochemistry/ Immunofluorescence GAPDH Antibody (1D4)
(19 Reviews)
(446 Publications)
Species: Av, Bv, Ca, Ch, ChHa, Dr, Eq, Fe, Ha, Hu, Mu, Ma-Op, Po, Pm, Rb, Rt, Sh, Ze
Applications: ChIP, ICC/IF, IHC, IHC-Fr, IP, KD, Simple Western, Single-Cell Western, WB
FKBP25 Antibody
NBP1-87929
Immunocytochemistry/ Immunofluorescence FKBP25 Antibody
Immunohistochemistry-Paraffin FKBP25 Antibody
Immunohistochemistry-Paraffin FKBP25 Antibody
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
FKBP12.6 Antibody
[Unconjugated]
AF4174
Western Blot FKBP12.6 Antibody [Unconjugated]
Simple Western FKBP12.6 Antibody [Unconjugated]
Immunohistochemistry FKBP12.6 Antibody [Unconjugated]
(3 Publications)
Species: Hu, Mu, Rt
Applications: IHC, Simple Western, WB
FKBP10 Antibody
NBP2-49242
Western Blot FKBP10 Antibody
Immunohistochemistry-Paraffin FKBP10 Antibody
Immunohistochemistry-Paraffin FKBP10 Antibody
Species: Hu
Applications: IHC, IHC-P, WB
FKBP6 Antibody
NBP2-38905
Immunohistochemistry-Paraffin FKBP6 Antibody
Immunohistochemistry-Paraffin FKBP6 Antibody
Western Blot FKBP6 Antibody
Species: Hu
Applications: IHC, IHC-P, WB
FKBP7 Antibody
NBP1-83889
Immunocytochemistry/ Immunofluorescence FKBP7 Antibody
Western Blot FKBP7 Antibody
Western Blot FKBP7 Antibody
(1 Publication)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, KD, WB
FKBP9 Antibody
NBP1-83887
Immunohistochemistry-Paraffin FKBP9 Antibody
Immunohistochemistry-Paraffin FKBP9 Antibody
Immunohistochemistry-Paraffin FKBP9 Antibody
(1 Publication)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
PPIL2 Antibody
NBP1-85360
Immunohistochemistry-Paraffin PPIL2 Antibody
Western Blot PPIL2 Antibody
Immunocytochemistry/ Immunofluorescence PPIL2 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
PPIL3 Antibody
NBP2-13794
Western Blot PPIL3 Antibody
Immunohistochemistry-Paraffin PPIL3 Antibody
Immunohistochemistry-Paraffin PPIL3 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
PPIL4 Antibody
NBP1-85921
Western Blot PPIL4 Antibody
Immunocytochemistry/ Immunofluorescence PPIL4 Antibody
Immunohistochemistry-Paraffin PPIL4 Antibody
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
PPIL6 Antibody
NBP1-88766
Western Blot PPIL6 Antibody
Immunocytochemistry/ Immunofluorescence PPIL6 Antibody
Immunohistochemistry-Paraffin PPIL6 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
APRIL/TNFSF13
[Biotin]
DY884B
N/A APRIL/TNFSF13 [Biotin]
N/A APRIL/TNFSF13 [Biotin]
(17 Publications)
Species: Hu
Applications: ELISA
PPIG Antibody (4F8)
H00009360-M02
Immunocytochemistry/ Immunofluorescence PPIG Antibody (4F8)
Sandwich ELISA PPIG Antibody (4F8)
Immunohistochemistry-Paraffin PPIG Antibody (4F8)
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB

Publications for Cyclophilin A Recombinant Protein Antigen (NBP2-46850PEP) (0)

There are no publications for Cyclophilin A Recombinant Protein Antigen (NBP2-46850PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Cyclophilin A Recombinant Protein Antigen (NBP2-46850PEP) (0)

There are no reviews for Cyclophilin A Recombinant Protein Antigen (NBP2-46850PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Cyclophilin A Recombinant Protein Antigen (NBP2-46850PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Cyclophilin A Products

Research Areas for Cyclophilin A Recombinant Protein Antigen (NBP2-46850PEP)

Find related products by research area.

Blogs on Cyclophilin A

There are no specific blogs for Cyclophilin A, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Analysis of cell line lysates probed with mouse mAb to GAPDH (theoretical molecular weight: 36 kDa), NB300-221, dilution 1:2,000: [1] protein standard, [2] HEK293, [3] HeLa, [4] SH-SY5Y, [5] COS1, [6] NIH-3T3, and [7] C6 cells. The GAPDH antibody reveals a single band at ~37 kDa in all cell lines. GAPDH is a house keeping protein, the level of which is relatively unaffected by most experimental manipulations, and, as a result, this antibody has been widely used as a western blotting loading control.
GAPDH Antibody (1D4)
NB300-221

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Cyclophilin A Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol PPIA