![Immunohistochemistry-Paraffin: Cyclin F Antibody [NBP2-57349] - Staining of human liver.](http://images.novusbio.com/fullsize/Cyclin-F-Antibody-Immunohistochemistry-Paraffin-NBP2-57349-img0007.jpg "Immunohistochemistry-Paraffin: Cyclin F Antibody [NBP2-57349] - Staining of human liver.")
| Reactivity | HuSpecies Glossary |
| Applications | IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: GDQESEGEKEGDVTAPSGILDVTVVYLNPEQHCCQESSDEEACPEDKGPQDPQALALDTQIPATPGPKPLVR |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | CCNF |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
![Western Blot PAK3 Antibody [Unconjugated]](https://images.novusbio.com/images2/PAK3_AF6897_Western_Blot_11082.jpg)
![Immunohistochemistry PAK3 Antibody [Unconjugated]](https://images.novusbio.com/images2/PAK3_AF6897_Immunohistochemistry_11144.jpg)
![Immunohistochemistry PAK3 Antibody [Unconjugated]](https://images.novusbio.com/images2/PAK3_AF6897_Immunohistochemistry_11480.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for Cyclin F Antibody (NBP2-57349)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | CCNF |
![Immunohistochemistry-Paraffin: Cyclin F Antibody [NBP2-57349] - Staining of human pancreas shows low expression as expected.](http://images.novusbio.com/fullsize/Cyclin-F-Antibody-Immunohistochemistry-Paraffin-NBP2-57349-img0002.jpg "Immunohistochemistry-Paraffin: Cyclin F Antibody [NBP2-57349] - Staining of human pancreas shows low expression as expected.")
![Immunohistochemistry-Paraffin: Cyclin F Antibody [NBP2-57349] - Staining of human tonsil shows high expression.](http://images.novusbio.com/fullsize/Cyclin-F-Antibody-Immunohistochemistry-Paraffin-NBP2-57349-img0003.jpg "Immunohistochemistry-Paraffin: Cyclin F Antibody [NBP2-57349] - Staining of human tonsil shows high expression.")
![Immunohistochemistry-Paraffin: Cyclin F Antibody [NBP2-57349] - Staining in human tonsil and pancreas tissues using anti-CCNF antibody. Corresponding CCNF RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/Cyclin-F-Antibody-Immunohistochemistry-Paraffin-NBP2-57349-img0004.jpg "Immunohistochemistry-Paraffin: Cyclin F Antibody [NBP2-57349] - Staining in human tonsil and pancreas tissues using anti-CCNF antibody. Corresponding CCNF RNA-seq data are presented for the same tissues.")
![Immunohistochemistry-Paraffin: Cyclin F Antibody [NBP2-57349] - Staining of human liver, lymph node, pancreas and skin using Anti-CCNF antibody NBP2-57349 (A) shows similar protein distribution across tissues to independent antibody NBP2-57569 (B).](http://images.novusbio.com/fullsize/Cyclin-F-Antibody-Immunohistochemistry-Paraffin-NBP2-57349-img0005.jpg "Immunohistochemistry-Paraffin: Cyclin F Antibody [NBP2-57349] - Staining of human liver, lymph node, pancreas and skin using Anti-CCNF antibody NBP2-57349 (A) shows similar protein distribution across tissues to independent antibody NBP2-57569 (B).")
![Immunohistochemistry-Paraffin: Cyclin F Antibody [NBP2-57349] - Staining of human lymph node.](http://images.novusbio.com/fullsize/Cyclin-F-Antibody-Immunohistochemistry-Paraffin-NBP2-57349-img0006.jpg "Immunohistochemistry-Paraffin: Cyclin F Antibody [NBP2-57349] - Staining of human lymph node.")
![Immunohistochemistry-Paraffin: Cyclin F Antibody [NBP2-57349] - Staining of human skin.](http://images.novusbio.com/fullsize/Cyclin-F-Antibody-Immunohistochemistry-Paraffin-NBP2-57349-img0008.jpg "Immunohistochemistry-Paraffin: Cyclin F Antibody [NBP2-57349] - Staining of human skin.")
![Immunohistochemistry Cyclin B1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Cyclin_B1_AF6000_Immunohistochemistry_11792.jpg)
![Western Blot Cyclin B1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Cyclin_B1_AF6000_Western_Blot_9526.jpg)
![Simple Western Cyclin B1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Cyclin_B1_AF6000_Simple_Western_20094.jpg)
![Western Blot p27/Kip1 [p Thr157] Antibody](https://images.novusbio.com/images2/p27_AF1555_Western_Blot_5119.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")