![Western Blot: CTCF Antibody (CL0305) [NBP2-52910] - Lane 1: Marker [kDa], Lane 2: Human cell line U-251 MG](http://images.novusbio.com/fullsize/CTCF-Antibody-CL0305-Western-Blot-NBP2-52910-img0007.jpg "Western Blot: CTCF Antibody (CL0305) [NBP2-52910] - Lane 1: Marker [kDa], Lane 2: Human cell line U-251 MG")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clone | CL0305 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: QNQTDGGEVVQDVNSSVQMVMMEQLDPTLLQMKTEVMEGTVAPEAEAAVDDTQIITLQVVNMEEQPINIGELQLVQVPVPVTVPVATTSVEELQGAYENEVSKEGLAESEPMICHTLPLPEGFQVVKVGANGEVETLEQGELPPQEDP |
| Epitope | NMEEQPINIGELQLV |
| Predicted Species | Mouse (99%), Rat (100%). Backed by our 100% Guarantee. |
| Isotype | IgG1 |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | CTCF |
| Purity | Protein A purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. For ICC/IF, PFA/Triton X-100 is recommended for fixation/permeabilization. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Protein A purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for CTCF Antibody (NBP2-52910)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | CTCF |
![Immunocytochemistry/Immunofluorescence: CTCF Antibody (CL0305) [NBP2-52910] - Staining of MCF7 cells using the Anti-CTCF monoclonal antibody, showing specific staining in the nucleoplasm in green. Microtubule- and nuclear probes are visualized in red and blue, respectively (where available).](http://images.novusbio.com/fullsize/CTCF-Antibody-CL0305-Immunocytochemistry-Immunofluorescence-NBP2-52910-img0012.jpg "Immunocytochemistry/Immunofluorescence: CTCF Antibody (CL0305) [NBP2-52910] - Staining of MCF7 cells using the Anti-CTCF monoclonal antibody, showing specific staining in the nucleoplasm in green. Microtubule- and nuclear probes are visualized in red and blue, respectively (where available).")
![Immunohistochemistry-Paraffin: CTCF Antibody (CL0305) [NBP2-52910] - Staining of human testis shows moderate nuclear positivity in a subset of cells in seminiferous ducts.](http://images.novusbio.com/fullsize/CTCF-Antibody-CL0305-Immunohistochemistry-Paraffin-NBP2-52910-img0011.jpg "Immunohistochemistry-Paraffin: CTCF Antibody (CL0305) [NBP2-52910] - Staining of human testis shows moderate nuclear positivity in a subset of cells in seminiferous ducts.")
![Immunohistochemistry-Paraffin: CTCF Antibody (CL0305) [NBP2-52910] - Staining of human endometrium shows moderate nuclear positivity in glandular and stromal cells.](http://images.novusbio.com/fullsize/CTCF-Antibody-CL0305-Immunohistochemistry-Paraffin-NBP2-52910-img0008.jpg "Immunohistochemistry-Paraffin: CTCF Antibody (CL0305) [NBP2-52910] - Staining of human endometrium shows moderate nuclear positivity in glandular and stromal cells.")
![Immunohistochemistry-Paraffin: CTCF Antibody (CL0305) [NBP2-52910] - Staining of human kidney shows moderate to strong nuclear positivity in cells in tubuli and glomeruli.](http://images.novusbio.com/fullsize/CTCF-Antibody-CL0305-Immunohistochemistry-Paraffin-NBP2-52910-img0009.jpg "Immunohistochemistry-Paraffin: CTCF Antibody (CL0305) [NBP2-52910] - Staining of human kidney shows moderate to strong nuclear positivity in cells in tubuli and glomeruli.")
![Immunohistochemistry-Paraffin: CTCF Antibody (CL0305) [NBP2-52910] - Staining of human small intestine shows strong nuclear positivity in glandular cells.](http://images.novusbio.com/fullsize/CTCF-Antibody-CL0305-Immunohistochemistry-Paraffin-NBP2-52910-img0010.jpg "Immunohistochemistry-Paraffin: CTCF Antibody (CL0305) [NBP2-52910] - Staining of human small intestine shows strong nuclear positivity in glandular cells.")
![SDS-PAGE IGF-II/IGF2 [Unconjugated]](https://images.novusbio.com/images2/IGF-II_292-G2_668.jpg)
![Bioactivity IGF-II/IGF2 [Unconjugated]](https://images.novusbio.com/images2/IGF-II_292-G2_669.jpg)
![Chromatin Immunoprecipitation (ChIP) Oct-3/4 Antibody [Unconjugated]](https://images.novusbio.com/images2/Oct-3_4_AF1759_Chromatin_Immunoprecipitation_11218.jpg)
![Immunocytochemistry Oct-3/4 Antibody [Unconjugated]](https://images.novusbio.com/images2/Oct-3_4_AF1759_Immunocytochemistry_7093.jpg)
![Simple Western Oct-3/4 Antibody [Unconjugated]](https://images.novusbio.com/images2/Oct3_4_AF1759_Simple_Western_20183.jpg)
![SDS-Page: Mouse IgG1 Isotype Control (MG1) [NBP1-97005] - Lane 1: , Non-reduced. M: Opal Pre-stained Ladder. Lane 2: , Reduced. Load: 1.0 ug per lane. Predicted/Observed: 120 kDa Non-reduced, 55 and 25 Reduced.](https://images.novusbio.com/images/Mouse-IgG1-Isotype-Control-MG1-SDS-Page-NBP1-97005-img0002.jpg "SDS-Page: Mouse IgG1 Isotype Control (MG1) [NBP1-97005] - Lane 1: , Non-reduced. M: Opal Pre-stained Ladder. Lane 2: , Reduced. Load: 1.0 ug per lane. Predicted/Observed: 120 kDa Non-reduced, 55 and 25 Reduced.")