Novus Biologicals products are now on bio-techne.com

Coagulation Factor II/Thrombin Recombinant Protein Antigen

Images

 
There are currently no images for F2 Protein (NBP2-33728PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Coagulation Factor II/Thrombin Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human F2.

Source: E. coli

Amino Acid Sequence: EGVWCYVAGKPGDFGYCDLNYCEEAVEEETGDGLDEDSDRAIEGRTATSEYQTFFNPRTFGSGEADCGLRPLFEKKSLE

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
F2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-33728.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Coagulation Factor II/Thrombin Recombinant Protein Antigen

  • coagulation factor II (thrombin) receptor-like 2
  • Coagulation factor II receptor-like 2 (protease-actovated receptor 3)
  • Coagulation factor II receptor-like 2
  • Coagulation Factor II
  • F2
  • PAR-3
  • PAR3proteinase-activated receptor 3
  • protease-activated receptor 3
  • proteinase-activated receptor-3
  • PT
  • serine protease
  • Thrombin receptor-like 2
  • Thrombin

Background

Proteinase-activated receptor 3 (PAR3) is a member of the Proteinase-Activated Receptor subfamily. The enzyme thrombin is involved in the activation of platelets, leukocytes, endothelial cells, and mesenchymal cells at sites of vascular injury. These cellular responses are triggered through proteolytic activation of PAR3 and other receptors by thrombin. It is believed that PAR3 functions as a cofactor for the cleavage and activation of PAR4. PAR3 expression has been documented in blood, bone marrow, lung, spleen, and vessel. ESTs have been isolated from head/neck, skeletal muscle, and skin libraries.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF1267
Species: Hu
Applications: IP, Neut, WB
H00005555-P01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
NBP3-25459
Species: Hu, Rt
Applications: WB
NBP1-33320
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
MAB1455
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
NB100-91761
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP1-89522
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
AF904
Species: Hu, Mu, Rt
Applications: IHC, Neut, Simple Western, WB
NB600-930
Species: Hu, Rt
Applications: ELISA, WB
NBP2-37607
Species: Hu, Rt
Applications: ELISA, IHC, IHC-P, WB
NBP1-19773
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
NB600-586
Species: Ca, Fe, Hu, Mu
Applications: Dual ISH-IHC, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-79286
Species: Rt
Applications: WB
NBP2-48990
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-20383
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
DTPA00
Species: Hu
Applications: ELISA

Publications for F2 Protein (NBP2-33728PEP) (0)

There are no publications for F2 Protein (NBP2-33728PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for F2 Protein (NBP2-33728PEP) (0)

There are no reviews for F2 Protein (NBP2-33728PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for F2 Protein (NBP2-33728PEP). (Showing 1 - 1 of 1 FAQ).

  1. Do you have neutralizing antibodies for anti-mouse Thrombin?
    • We currently have 1 neutralizing Thrombin antibody (NBP1-95029), however it is an anti-human antibody and has only been validated in human samples. If you would like to test this antibody in mouse samples, you may be interested in participating in our Innovators Reward Program.

Additional Coagulation Factor II/Thrombin Products

Research Areas for F2 Protein (NBP2-33728PEP)

Find related products by research area.

Blogs on Coagulation Factor II/Thrombin

There are no specific blogs for Coagulation Factor II/Thrombin, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Coagulation Factor II/Thrombin Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol F2