![Western Blot: Clathrin Heavy Chain 1/CHC17 Antibody [NBP2-49293] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4Lane 3: Human cell line U-251 MGLane 4: Human plasmaLane 5: Human Liver tissueLane 6: Human Tonsil tissue](http://images.novusbio.com/fullsize/Clathrin-Heavy-Chain-1-CHC17-Antibody-Western-Blot-NBP2-49293-img0003.jpg "Western Blot: Clathrin Heavy Chain 1/CHC17 Antibody [NBP2-49293] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4Lane 3: Human cell line U-251 MGLane 4: Human plasmaLane 5: Human Liver tissueLane 6: Human Tonsil tissue")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: ESLRKEEEQATETQPIVYGQPQLMLTAGPSVAVPPQ |
| Predicted Species | Mouse (100%), Rat (100%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | CLTC |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Reviewed Applications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Simple Western alpha-Fetoprotein/AFP Antibody (189502) [Unconjugated]](https://images.novusbio.com/images2/16253.jpg)
![Knockout Validated alpha-Fetoprotein/AFP Antibody (189502) [Unconjugated]](https://images.novusbio.com/images2/alphaFetoprotein_MAB1368_Knockout_Validated_21503.jpg)
![Knockout Validated alpha-Fetoprotein/AFP Antibody (189502) [Unconjugated]](https://images.novusbio.com/images2/alphaFetoprotein_MAB1368_Knockout_Validated_22402.jpg)
![Simple Western Albumin Antibody (188835) [Unconjugated] - Serum](https://images.novusbio.com/images2/Albumin_MAB1455_Simple_Western_21888.jpg)
![Immunocytochemistry Albumin Antibody (188835) [Unconjugated] - Serum](https://images.novusbio.com/images2/Albumin_MAB1455_Immunocytochemistry__Immunofluorescence_17777.jpg)
![Immunohistochemistry Albumin Antibody (188835) [Unconjugated] - Serum](https://images.novusbio.com/images2/Albumin_MAB1455_Immunohistochemistry_23317.jpg)
| Images | Ratings | Applications | Species | Date | Details | ||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
|
reviewed by:
Patricia Carulla Martí |
ICC | Human | 05/25/2023 |
Summary
|
Secondary Antibodies |
Isotype Controls |
Research Areas for Clathrin Heavy Chain 1/CHC17 Antibody (NBP2-49293)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | CLTC |
![Immunocytochemistry/Immunofluorescence: Clathrin Heavy Chain 1/CHC17 Antibody [NBP2-49293] - Staining of human cell line U-251 MG shows localization to endosomes & lysosomes.](http://images.novusbio.com/fullsize/Clathrin-Heavy-Chain-1-CHC17-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-49293-img0004.jpg "Immunocytochemistry/Immunofluorescence: Clathrin Heavy Chain 1/CHC17 Antibody [NBP2-49293] - Staining of human cell line U-251 MG shows localization to endosomes & lysosomes.")
![Immunohistochemistry-Paraffin: Clathrin Heavy Chain 1/CHC17 Antibody [NBP2-49293] - Staining of human skeletal muscle shows low positivity in myocytes as expected.](http://images.novusbio.com/fullsize/Clathrin-Heavy-Chain-1-CHC17-Antibody-Immunohistochemistry-Paraffin-NBP2-49293-img0008.jpg "Immunohistochemistry-Paraffin: Clathrin Heavy Chain 1/CHC17 Antibody [NBP2-49293] - Staining of human skeletal muscle shows low positivity in myocytes as expected.")
![Immunohistochemistry-Paraffin: Clathrin Heavy Chain 1/CHC17 Antibody [NBP2-49293] - Staining of human cerebral cortex shows moderate cytoplasmic positivity in neuropil.](http://images.novusbio.com/fullsize/Clathrin-Heavy-Chain-1-CHC17-Antibody-Immunohistochemistry-Paraffin-NBP2-49293-img0005.jpg "Immunohistochemistry-Paraffin: Clathrin Heavy Chain 1/CHC17 Antibody [NBP2-49293] - Staining of human cerebral cortex shows moderate cytoplasmic positivity in neuropil.")
![Immunohistochemistry-Paraffin: Clathrin Heavy Chain 1/CHC17 Antibody [NBP2-49293] - Staining of human placenta shows strong membranous positivity in trophoblstic cells.](http://images.novusbio.com/fullsize/Clathrin-Heavy-Chain-1-CHC17-Antibody-Immunohistochemistry-Paraffin-NBP2-49293-img0006.jpg "Immunohistochemistry-Paraffin: Clathrin Heavy Chain 1/CHC17 Antibody [NBP2-49293] - Staining of human placenta shows strong membranous positivity in trophoblstic cells.")
![Immunohistochemistry-Paraffin: Clathrin Heavy Chain 1/CHC17 Antibody [NBP2-49293] - Staining of human prostate shows moderate granular cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/Clathrin-Heavy-Chain-1-CHC17-Antibody-Immunohistochemistry-Paraffin-NBP2-49293-img0007.jpg "Immunohistochemistry-Paraffin: Clathrin Heavy Chain 1/CHC17 Antibody [NBP2-49293] - Staining of human prostate shows moderate granular cytoplasmic positivity in glandular cells.")
![Immunocytochemistry/Immunofluorescence: Clathrin Heavy Chain 1/CHC17 Antibody [NBP2-49293] - SHSY5Y cells differentiated into neurons. Green: CLTC antibody diluted 1:100 in PBS-Triton 0.2%X-100/BSA 1%. 2 hours at RT. Blue: DAPI. Image from verified customer review](http://images.novusbio.com/fullsize/antibody/nbp2-49293_rabbit-polyclonal-clathrin-heavy-chain-1-chc17-antibody-162023151622.jpg "Immunocytochemistry/Immunofluorescence: Clathrin Heavy Chain 1/CHC17 Antibody [NBP2-49293] - SHSY5Y cells differentiated into neurons. Green: CLTC antibody diluted 1:100 in PBS-Triton 0.2%X-100/BSA 1%. 2 hours at RT. Blue: DAPI. Image from verified customer review")
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![Immunocytochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/Insulin_MAB1417_Immunocytochemistry_9376.jpg)
![Immunohistochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/mab1417_human-bovine-mouse-insulin-mab-clone-182410-immunohistochemistry-308202115145.jpg)
![N/A Complement Component C5a [Biotin]](https://images.novusbio.com/images2/DATA_Complement_Component_C5a_DY2037_ELISA_1753.jpg)
![N/A IL-10 [Biotin]](https://images.novusbio.com/images2/DATA_IL10_DY417_ELISA_2014.jpg)
![Bioactivity IL-4 [Unconjugated]](https://images.novusbio.com/images/protein/6507-ilcf_recombinant-human-il-4-cho-expressed-protein-cf-bioactivity-272020133214.jpg)
![Bioactivity IFN-gamma [Unconjugated]](https://images.novusbio.com/images2/IFNgamma_285IF_2848.jpg)
![SDS-PAGE IFN-gamma [Unconjugated]](https://images.novusbio.com/images2/IFN-gamma_285-IF_230.jpg)
![SEC-MALS IFN-gamma [Unconjugated]](https://images.novusbio.com/images/285-if_recombinant-human-ifn-gamma-protein-sec-mals-1520239228..jpg)
![Western Blot ALK/CD246 Antibody [Unconjugated]](https://images.novusbio.com/images2/ALK_AF4210_Western_Blot_12746.jpg)
![Immunohistochemistry ALK/CD246 Antibody [Unconjugated]](https://images.novusbio.com/images2/12780.jpg)
![Simple Western ALK/CD246 Antibody [Unconjugated]](https://images.novusbio.com/images/antibody/af4210_human-alk-cd246-affinity-purified-pab-simple-western-296202315837.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")
