Home » Clathrin Heavy Chain 1/CHC17 » Clathrin Heavy Chain 1/CHC17 Antibodies » Clathrin Heavy Chain 1/CHC17 Antibody (9M2G2)
Novus Biologicals products are now on bio-techne.com

Clathrin Heavy Chain 1/CHC17 Antibody (9M2G2)

 Submit a Review

Images

 
(
Enlarge)
Western Blot: Clathrin Heavy Chain 1/CHC17 Antibody (9M2G2) [NBP3-16518] - Analysis of extracts of various cell lines, using Clathrin Heavy Chain 1/CHC17 Rabbit mAb (NBP3-16518) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.
Western Blot: Clathrin Heavy Chain 1/CHC17 Antibody (9M2G2) [NBP3-16518] - Analysis of extracts of various cell lines, using Clathrin Heavy Chain 1/CHC17 Rabbit mAb (NBP3-16518) at 1:1000 dilution. Secondary antibody: ...read more
Immunocytochemistry/ Immunofluorescence: Clathrin Heavy Chain 1/CHC17 Antibody (9M2G2) [NBP3-16518] - Immunofluorescence analysis of U-2 OS cells using Clathrin Heavy Chain 1/CHC17 Rabbit mAb (NBP3-16518) at dilution of ...read more
Immunohistochemistry-Paraffin: Clathrin Heavy Chain 1/CHC17 Antibody (9M2G2) [NBP3-16518] - Mouse kidney using Clathrin Heavy Chain 1/CHC17 Rabbit mAb (NBP3-16518) at dilution of 1:100 (40x lens).Perform microwave ...read more
Immunohistochemistry-Paraffin: Clathrin Heavy Chain 1/CHC17 Antibody (9M2G2) [NBP3-16518] - Rat testis using Clathrin Heavy Chain 1/CHC17 Rabbit mAb (NBP3-16518) at dilution of 1:100 (40x lens).Perform microwave antigen ...read more
Immunohistochemistry-Paraffin: Clathrin Heavy Chain 1/CHC17 Antibody (9M2G2) [NBP3-16518] - Human colon using Clathrin Heavy Chain 1/CHC17 Rabbit mAb (NBP3-16518) at dilution of 1:100 (40x lens).Perform microwave ...read more
Immunoprecipitation: Clathrin Heavy Chain 1/CHC17 Antibody (9M2G2) [NBP3-16518] - Analysis of 300ug extracts of NIH/3T3 cells using 3ug Clathrin Heavy Chain 1/CHC17 antibody (NBP3-16518). Western blot was performed from ...read more

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IP
Clone
9M2G2
Clonality
Monoclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

Clathrin Heavy Chain 1/CHC17 Antibody (9M2G2) Summary

Additional Information
Recombinant Monoclonal Antibody
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 200-300 of human Clathrin Heavy Chain 1/CHC17 (Q00610). SFAQFKMEGNAEESTLFCFAVRGQAGGKLHIIEVGTPPTGNQPFPKKAVDVFFPPEAQNDFPVAMQISEKHDVVFLITKYGYIHLYDLETGTCIYMNRISG
Isotype
IgG
Clonality
Monoclonal
Host
Rabbit
Gene
CLTC
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin
  • Immunoprecipitation 0.5ug-4ug antibody for 200ug-400ug extracts of whole cells
  • Western Blot 1:500 - 1:2000

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS, 0.05% BSA, 50% glycerol, pH7.3
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for Clathrin Heavy Chain 1/CHC17 Antibody (9M2G2)

  • CHC
  • CHC17
  • Clathrin Heavy Chain 1
  • Clathrin heavy chain on chromosome 17
  • clathrin, heavy chain (Hc)
  • clathrin, heavy chain
  • clathrin, heavy polypeptide (Hc)
  • clathrin, heavy polypeptide-like 2
  • CLH17
  • CLH-17
  • CLTC
  • CLTCL2
  • Hc
  • KIAA0034

Background

Clathrin is a major protein component of the cytoplasmic face of intracellular organelles, called coated vesicles and coated pits. These specialized organelles are involved in the intracellular trafficking of receptors and endocytosis of a variety of macromolecules. The basic subunit of the clathrin coat is composed of three heavy chains (192 kDa) and three light chains (LCa or LCb, 25-29 kDa) and self assembles into a polyhedral cytoskeletal element. Self assembly facilitates clathrin's central role in membrane sorting and selective transport within the cell.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

TNF-alpha
[Unconjugated]
210-TA
SDS-PAGE TNF-alpha [Unconjugated]
Bioactivity TNF-alpha [Unconjugated]
SEC-MALS TNF-alpha [Unconjugated]
(3 Reviews)
(808 Publications)
Species: Hu
Applications: BA
IFN-alpha 1
Antibody
NBP2-75930
Western Blot IFN-alpha 1 Antibody
Immunocytochemistry/ Immunofluorescence IFN-alpha 1 Antibody
Immunocytochemistry/ Immunofluorescence IFN-alpha 1 Antibody
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Sialin/SLC17A5
Antibody
NBP2-20383
Immunohistochemistry-Paraffin Sialin/SLC17A5 Antibody
Western Blot Sialin/SLC17A5 Antibody
Immunocytochemistry/ Immunofluorescence Sialin/SLC17A5 Antibody
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Insulin Antibody
(182410) [Unconjugate ...
MAB1417
Immunocytochemistry Insulin Antibody (182410) [Unconjugated]
Immunohistochemistry Insulin Antibody (182410) [Unconjugated]
(24 Publications)
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
Complement
Component C5a [Biotin
DY2037
N/A Complement Component C5a [Biotin]
(26 Publications)
Species: Hu
Applications: ELISA
Complement C4b/d
Antibody (16D2)
NB200-541
Western Blot Complement C4b/d Antibody (16D2)
(12 Publications)
Species: Mu
Applications: IA, ICC/IF, IHC, IHC-Fr, IP, WB
Prothrombin
Antibody
NBP1-58268
Immunohistochemistry-Paraffin Prothrombin Antibody
Immunohistochemistry-Paraffin Prothrombin Antibody
Western Blot Prothrombin Antibody
(1 Review)
(3 Publications)
Species: Hu, Mu
Applications: IHC, IHC-P, WB
IL-10 [Biotin]
DY417
N/A IL-10 [Biotin]
(291 Publications)
Species: Mu
Applications: ELISA

alpha-Fetoprotein/AFP ...
MAB1368
Simple Western alpha-Fetoprotein/AFP Antibody (189502) [Unconjugated]
Knockout Validated alpha-Fetoprotein/AFP Antibody (189502) [Unconjugated]
Knockout Validated alpha-Fetoprotein/AFP Antibody (189502) [Unconjugated]
(3 Reviews)
(90 Publications)
Species: Hu, Mu
Applications: CyTOF-ready, ICC, ICFlow, KO, Simple Western, WB
Albumin Antibody
(188835) [Unconjugate ...
MAB1455
Simple Western Albumin Antibody (188835) [Unconjugated] - Serum
Immunocytochemistry Albumin Antibody (188835) [Unconjugated] - Serum
Immunohistochemistry Albumin Antibody (188835) [Unconjugated] - Serum
(3 Reviews)
(54 Publications)
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
IL-4 [Unconjugated]
6507-IL/CF
Bioactivity IL-4 [Unconjugated]
(3 Publications)
Species: Hu
Applications: BA
MCT1/SLC16A1
Antibody - BSA Free
NBP1-59656
Western Blot MCT1/SLC16A1 Antibody - BSA Free
Knockdown Validated MCT1/SLC16A1 Antibody - BSA Free
Western Blot MCT1/SLC16A1 Antibody - BSA Free
(15 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, KD, WB
IFN-gamma
[Unconjugated]
285-IF
Bioactivity IFN-gamma [Unconjugated]
SDS-PAGE IFN-gamma [Unconjugated]
SEC-MALS IFN-gamma [Unconjugated]
(2 Reviews)
(447 Publications)
Species: Hu
Applications: BA
TTF2 Antibody (1E8)
H00008458-M06
Immunocytochemistry/ Immunofluorescence TTF2 Antibody (1E8)
Western Blot TTF2 Antibody (1E8)
Western Blot TTF2 Antibody (1E8)
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
GGT1 Antibody (1F9)
H00002678-M01
Western Blot GGT1 Antibody (1F9)
Immunohistochemistry-Paraffin GGT1 Antibody (1F9)
Immunoprecipitation GGT1 Antibody (1F9)
(10 Publications)
Species: Hu, Mu, Ye
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, S-ELISA, WB
Cytochrome c
Antibody (7H8.2C12) - ...
NB100-56503
Flow Cytometry Cytochrome c Antibody (7H8.2C12) - BSA Free
Flow (Intracellular) Cytochrome c Antibody (7H8.2C12) - BSA Free
Western Blot Cytochrome c Antibody (7H8.2C12) - BSA Free
(61 Publications)
Species: Dr, Hu, Mu, Rb, Rt
Applications: Flow-CS, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-P, Simple Western, WB
ALK/CD246 Antibody
[Unconjugated]
AF4210
Western Blot ALK/CD246 Antibody [Unconjugated]
Immunohistochemistry ALK/CD246 Antibody [Unconjugated]
Simple Western ALK/CD246 Antibody [Unconjugated]
(1 Review)
Species: Hu
Applications: IHC, Simple Western, WB
Clathrin Heavy
Chain 1/CHC17 Antibod ...
NBP3-16518
Clathrin Heavy Chain 1/CHC17 Antibody (9M2G2)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IP

Publications for Clathrin Heavy Chain 1/CHC17 Antibody (NBP3-16518) (0)

There are no publications for Clathrin Heavy Chain 1/CHC17 Antibody (NBP3-16518).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Clathrin Heavy Chain 1/CHC17 Antibody (NBP3-16518) (0)

There are no reviews for Clathrin Heavy Chain 1/CHC17 Antibody (NBP3-16518). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Clathrin Heavy Chain 1/CHC17 Antibody (NBP3-16518) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Clathrin Heavy Chain 1/CHC17 Products

Research Areas for Clathrin Heavy Chain 1/CHC17 Antibody (NBP3-16518)

Find related products by research area.

Blogs on Clathrin Heavy Chain 1/CHC17

There are no specific blogs for Clathrin Heavy Chain 1/CHC17, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Clathrin Heavy Chain 1/CHC17 Antibody (9M2G2) and receive a gift card or discount.


Bioinformatics

Gene Symbol CLTC