![Immunocytochemistry/Immunofluorescence: CIZ1 Antibody [NBP2-33890] - Staining of human cell line MCF7 shows localization to nucleoplasm.](http://images.novusbio.com/fullsize/CIZ1-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-33890-img0004.jpg "Immunocytochemistry/Immunofluorescence: CIZ1 Antibody [NBP2-33890] - Staining of human cell line MCF7 shows localization to nucleoplasm.")
| Reactivity | Hu, MuSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: EQTPVVVHVCGLEMPPDAVEAGGGMEKTLPEPVGTQVSMEEIQNESACGLDVGECENRAREMPGVWGAGGSLKVTIL |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | CIZ1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Western Blot PAK3 Antibody [Unconjugated]](https://images.novusbio.com/images2/PAK3_AF6897_Western_Blot_11082.jpg)
![Immunohistochemistry PAK3 Antibody [Unconjugated]](https://images.novusbio.com/images2/PAK3_AF6897_Immunohistochemistry_11144.jpg)
![Immunohistochemistry PAK3 Antibody [Unconjugated]](https://images.novusbio.com/images2/PAK3_AF6897_Immunohistochemistry_11480.jpg)
| Publication using NBP2-33890 | Applications | Species |
|---|---|---|
| Xiao J, Vemula SR, Xue Y et al. Motor phenotypes and molecular networks associated with germline deficiency of Ciz1. Exp. Neurol. 2016-05-06 [PMID: 27163549] (WB, IF/IHC, Mouse) | WB, IF/IHC | Mouse |
Secondary Antibodies |
Isotype Controls |
Research Areas for CIZ1 Antibody (NBP2-33890)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunohistochemistry-Paraffin: CIZ1 Antibody [NBP2-33890] - Staining of human vulva/anal skin shows strong nuclear positivity in epidermal cells.](http://images.novusbio.com/fullsize/CIZ1-Antibody-Immunohistochemistry-Paraffin-NBP2-33890-img0005.jpg "Immunohistochemistry-Paraffin: CIZ1 Antibody [NBP2-33890] - Staining of human vulva/anal skin shows strong nuclear positivity in epidermal cells.")
![Immunohistochemistry-Paraffin: CIZ1 Antibody [NBP2-33890] - Staining of human testis shows moderate nuclear positivity in spermatids.](http://images.novusbio.com/fullsize/antibody/nbp2-33890_rabbit-polyclonal-ciz1-antibody-immunohistochemistry-paraffin-251202410146..jpg "Immunohistochemistry-Paraffin: CIZ1 Antibody [NBP2-33890] - Staining of human testis shows moderate nuclear positivity in spermatids.")
![Immunohistochemistry-Paraffin: CIZ1 Antibody [NBP2-33890] - Staining of human rectum shows strong nuclear positivity in glandular cells.](http://images.novusbio.com/fullsize/antibody/nbp2-33890_rabbit-polyclonal-ciz1-antibody-immunohistochemistry-paraffin-2512024101827..jpg "Immunohistochemistry-Paraffin: CIZ1 Antibody [NBP2-33890] - Staining of human rectum shows strong nuclear positivity in glandular cells.")
![Immunohistochemistry-Paraffin: CIZ1 Antibody [NBP2-33890] -Staining of human liver shows no nuclear positivity in hepatocytes as expected.](http://images.novusbio.com/fullsize/antibody/nbp2-33890_rabbit-polyclonal-ciz1-antibody-immunohistochemistry-paraffin-251202410209..jpg "Immunohistochemistry-Paraffin: CIZ1 Antibody [NBP2-33890] -Staining of human liver shows no nuclear positivity in hepatocytes as expected.")
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")