![Western Blot: ZNF266 Antibody (4G5) [H00010781-M02] - Analysis of ZNF266 expression in transfected 293T cell line by ZNF266 monoclonal antibody (M02), clone 4G5.Lane 1: ZNF266 transfected lysate(29.9 KDa).Lane 2: Non-transfected lysate.](http://images.novusbio.com/fullsize/ZNF266-Antibody-4G5-Western-Blot-H00010781-M02-img0005.jpg "Western Blot: ZNF266 Antibody (4G5) [H00010781-M02] - Analysis of ZNF266 expression in transfected 293T cell line by ZNF266 monoclonal antibody (M02), clone 4G5.Lane 1: ZNF266 transfected lysate(29.9 KDa).Lane 2: Non-transfected lysate.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ELISA, IHC |
| Clone | 4G5 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Immunogen | ZNF266 (NP_006622.2, 274 a.a. ~ 346 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. GRAFTVSSCLSQHMKIHVGEKPYECKECGIAFTRSSQLTEHLKTHTAKDPFECKICGKSFRNSSCLSDHFRIH |
| Specificity | ZNF266 - zinc finger protein 266 (4G5) |
| Isotype | IgG2a Kappa |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | ZNF266 |
| Purity | IgG purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Application Notes | Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | In 1x PBS, pH 7.4 |
| Preservative | No Preservative |
| Purity | IgG purified |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunohistochemistry-Paraffin: ZNF266 Antibody (4G5) [H00010781-M02] - Analysis of monoclonal antibody to ZNF266 on formalin-fixed paraffin-embedded human kidney. Antibody concentration 1.5 ug/ml.](http://images.novusbio.com/fullsize/ZNF266-Antibody-4G5-Immunohistochemistry-Paraffin-H00010781-M02-img0003.jpg "Immunohistochemistry-Paraffin: ZNF266 Antibody (4G5) [H00010781-M02] - Analysis of monoclonal antibody to ZNF266 on formalin-fixed paraffin-embedded human kidney. Antibody concentration 1.5 ug/ml.")
![Sandwich ELISA: ZNF266 Antibody (4G5) [H00010781-M02] - Detection limit for recombinant GST tagged ZNF266 is 1 ng/ml as a capture antibody.](http://images.novusbio.com/fullsize/ZNF266-Antibody-4G5-Sandwich-ELISA-H00010781-M02-img0004.jpg "Sandwich ELISA: ZNF266 Antibody (4G5) [H00010781-M02] - Detection limit for recombinant GST tagged ZNF266 is 1 ng/ml as a capture antibody.")
![Western Blot c-jun [p Ser63] Antibody (1018Y) [Unconjugated]](https://images.novusbio.com/images2/cJun_MAB8930_Western_Blot_18923.jpg)
![Immunocytochemistry c-jun [p Ser63] Antibody (1018Y) [Unconjugated]](https://images.novusbio.com/images2/cJun_MAB8930_Immunocytochemistry__Immunofluorescence_18945.jpg)
![Simple Western c-jun [p Ser63] Antibody (1018Y) [Unconjugated]](https://images.novusbio.com/images2/cJun_MAB8930_Simple_Western_19175.jpg)
