![Western Blot: Citidine Deaminase Antibody [NBP2-39019] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG. Lane 4: Human Plasma. Lane 5: Human liver tissue](http://images.novusbio.com/fullsize/Citidine-Deaminase-Antibody-Western-Blot-NBP2-39019-img0003.jpg "Western Blot: Citidine Deaminase Antibody [NBP2-39019] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG. Lane 4: Human Plasma. Lane 5: Human liver tissue")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: GICAERTAIQKAVSEGYKDFRAIAIASDMQDDFISPCGACRQVMREFGTNWPVYMTKPDGTYIVMTVQE |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | CDA |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for Citidine Deaminase Antibody (NBP2-39019)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunocytochemistry/Immunofluorescence: Citidine Deaminase Antibody [NBP2-39019] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/Citidine-Deaminase-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-39019-img0004.jpg "Immunocytochemistry/Immunofluorescence: Citidine Deaminase Antibody [NBP2-39019] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm. Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: Citidine Deaminase Antibody [NBP2-39019] - Staining of human cerebral cortex shows low expression as expected.](http://images.novusbio.com/fullsize/Citidine-Deaminase-Antibody-Immunohistochemistry-Paraffin-NBP2-39019-img0005.jpg "Immunohistochemistry-Paraffin: Citidine Deaminase Antibody [NBP2-39019] - Staining of human cerebral cortex shows low expression as expected.")
![Immunohistochemistry: Citidine Deaminase Antibody [NBP2-39019] - Staining of human bone marrow shows moderate cytoplasmic and nuclear positivity in hematopoietic cells.](http://images.novusbio.com/fullsize/Citidine-Deaminase-Antibody-Immunohistochemistry-NBP2-39019-img0002.jpg "Immunohistochemistry: Citidine Deaminase Antibody [NBP2-39019] - Staining of human bone marrow shows moderate cytoplasmic and nuclear positivity in hematopoietic cells.")
![Immunohistochemistry-Paraffin: Citidine Deaminase Antibody [NBP2-39019] - Staining in human bone marrow and cerebral cortex tissues using anti-CDA antibody. Corresponding CDA RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/Citidine-Deaminase-Antibody-Immunohistochemistry-Paraffin-NBP2-39019-img0006.jpg "Immunohistochemistry-Paraffin: Citidine Deaminase Antibody [NBP2-39019] - Staining in human bone marrow and cerebral cortex tissues using anti-CDA antibody. Corresponding CDA RNA-seq data are presented for the same tissues.")
![Bioactivity IL-4 [Unconjugated]](https://images.novusbio.com/images/protein/6507-ilcf_recombinant-human-il-4-cho-expressed-protein-cf-bioactivity-272020133214.jpg)
![Immunohistochemistry Apolipoprotein B/ApoB Antibody (369717) [Unconjugated]](https://images.novusbio.com/images2/Apolipoprotein_B_MAB4124_Immunohistochemistry_22141.jpg)
![Western Blot Apolipoprotein B/ApoB Antibody (369717) [Unconjugated]](https://images.novusbio.com/images2/Apolipoprotein_B_MAB4124_Western_Blot_20437.jpg)
![Simple Western Apolipoprotein B/ApoB Antibody (369717) [Unconjugated]](https://images.novusbio.com/images/antibody/mab4124_human-apolipoprotein-b-apob-mab-clone-369717-simple-western-301202492438..jpg)
![N/A CD40 Ligand/TNFSF5 [HRP]](https://images.novusbio.com/images2/CD40_Ligand_DCDL40_ELISA_60.jpg)
![N/A CD40 Ligand/TNFSF5 [HRP]](https://images.novusbio.com/images2/DATA_CD40_Ligand_DCDL40_ELISA_624.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")