![Immunohistochemistry-Paraffin: APOBEC3G Antibody [NBP1-88592] - Staining of human spleen shows moderate to strong cytoplasmic positivity in cells in red pulp.](http://images.novusbio.com/fullsize/APOBEC3G-Antibody-Immunohistochemistry-Paraffin-NBP1-88592-img0009.jpg "Immunohistochemistry-Paraffin: APOBEC3G Antibody [NBP1-88592] - Staining of human spleen shows moderate to strong cytoplasmic positivity in cells in red pulp.")
| Reactivity | HuSpecies Glossary |
| Applications | IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: MHNDTWVLLNQRRGFLCNQAPHKHGFLEGRHAELCFLDVIPFWKLDLDQDYRVTCFTSWSPCFSCAQEMAKFISKNKHVSLCIFTARIYDDQGRCQEGLRTLAEAGAKISIMTYSEFKHCWDTFVDHQGCPFQPWDGLDEHSQDLSGRL |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | APOBEC3G |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | APOBEC3G |
![Immunohistochemistry-Paraffin: APOBEC3G Antibody [NBP1-88592] - Staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts.](http://images.novusbio.com/fullsize/APOBEC3G-Antibody-Immunohistochemistry-Paraffin-NBP1-88592-img0003.jpg "Immunohistochemistry-Paraffin: APOBEC3G Antibody [NBP1-88592] - Staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts.")
![Immunohistochemistry-Paraffin: APOBEC3G Antibody [NBP1-88592] - Staining of human pancreas shows no positivity as expected.](http://images.novusbio.com/fullsize/APOBEC3G-Antibody-Immunohistochemistry-Paraffin-NBP1-88592-img0005.jpg "Immunohistochemistry-Paraffin: APOBEC3G Antibody [NBP1-88592] - Staining of human pancreas shows no positivity as expected.")
![Immunohistochemistry-Paraffin: APOBEC3G Antibody [NBP1-88592] - Staining of human stomach shows moderate to strong cytoplasmic positivity in lymphoid cells.](http://images.novusbio.com/fullsize/APOBEC3G-Antibody-Immunohistochemistry-Paraffin-NBP1-88592-img0006.jpg "Immunohistochemistry-Paraffin: APOBEC3G Antibody [NBP1-88592] - Staining of human stomach shows moderate to strong cytoplasmic positivity in lymphoid cells.")
![Immunohistochemistry-Paraffin: APOBEC3G Antibody [NBP1-88592] - Staining of human lymph node shows moderate to strong cytoplasmic positivity in lymphoid cells.](http://images.novusbio.com/fullsize/APOBEC3G-Antibody-Immunohistochemistry-Paraffin-NBP1-88592-img0007.jpg "Immunohistochemistry-Paraffin: APOBEC3G Antibody [NBP1-88592] - Staining of human lymph node shows moderate to strong cytoplasmic positivity in lymphoid cells.")
![Immunohistochemistry-Paraffin: APOBEC3G Antibody [NBP1-88592] - Analysis in human lymph node and pancreas tissues. Corresponding APOBEC3G RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/APOBEC3G-Antibody-Immunohistochemistry-Paraffin-NBP1-88592-img0008.jpg "Immunohistochemistry-Paraffin: APOBEC3G Antibody [NBP1-88592] - Analysis in human lymph node and pancreas tissues. Corresponding APOBEC3G RNA-seq data are presented for the same tissues.")
![Flow Cytometry CCR5 Antibody (45531) [Unconjugated]](https://images.novusbio.com/images2/CCR5_MAB182_Flow_Cytometry_22407.jpg)
![Neutralization CCR5 Antibody (45531) [Unconjugated]](https://images.novusbio.com/images2/CCR5_MAB182_Block_Neutralize_9044.jpg)
![Immunocytochemistry CCR5 Antibody (45531) [Unconjugated]](https://images.novusbio.com/images2/CCR5_MAB182_Immunocytochemistry_9681.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")