![Western Blot: CHD1 Antibody [NBP3-02966] - Analysis of extracts of Jurkat cells, using CHD1 antibody at 1:500 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit. Exposure time: 90s.](http://images.novusbio.com/fullsize/CHD1-Antibody-Western-Blot-NBP3-02966-img0006.jpg "Western Blot: CHD1 Antibody [NBP3-02966] - Analysis of extracts of Jurkat cells, using CHD1 antibody at 1:500 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit. Exposure time: 90s.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, IHC, KO |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1600 to the C-terminus of human CHD1 (NP_001261.2). DREKHRKLDDHRSRDHRSNLEGSLKDRSHSDHRSHSDHRLHSDHRSSSEYTHHKSSRDYRYHSDWQMDHRASSSGPRSPLDQRSPYGSRSPFEHSVEHKSTPEHTWSSRKT |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | CHD1 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Theoretical MW | 196 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS with 50% glycerol, pH7.3. |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
![Immunocytochemistry E-Cadherin Antibody [Unconjugated]](https://images.novusbio.com/images2/ECadherin_AF748_Immunocytochemistry_15885.jpg)
![Immunohistochemistry E-Cadherin Antibody [Unconjugated]](https://images.novusbio.com/images2/ECadherin_AF748_Immunohistochemistry_15886.jpg)
![Immunocytochemistry E-Cadherin Antibody [Unconjugated]](https://images.novusbio.com/images2/ECadherin_AF748_Immunocytochemistry_16572.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for CHD1 Antibody (NBP3-02966)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | CHD1 |
![Immunohistochemistry-Paraffin: CHD1 Antibody [NBP3-02966] - Rat brain using CHD1 antibody (NBP3-02966) at dilution of 1:100 (40x lens).](http://images.novusbio.com/fullsize/CHD1-Antibody-Immunohistochemistry-Paraffin-NBP3-02966-img0003.jpg "Immunohistochemistry-Paraffin: CHD1 Antibody [NBP3-02966] - Rat brain using CHD1 antibody (NBP3-02966) at dilution of 1:100 (40x lens).")
![Immunohistochemistry-Paraffin: CHD1 Antibody [NBP3-02966] - Mouse brain using CHD1 antibody (NBP3-02966) at dilution of 1:100 (40x lens).](http://images.novusbio.com/fullsize/CHD1-Antibody-Immunohistochemistry-Paraffin-NBP3-02966-img0001.jpg "Immunohistochemistry-Paraffin: CHD1 Antibody [NBP3-02966] - Mouse brain using CHD1 antibody (NBP3-02966) at dilution of 1:100 (40x lens).")
![Immunohistochemistry-Paraffin: CHD1 Antibody [NBP3-02966] - Human liver damage using CHD1 antibody (NBP3-02966) at dilution of 1:100 (40x lens).](http://images.novusbio.com/fullsize/CHD1-Antibody-Immunohistochemistry-Paraffin-NBP3-02966-img0002.jpg "Immunohistochemistry-Paraffin: CHD1 Antibody [NBP3-02966] - Human liver damage using CHD1 antibody (NBP3-02966) at dilution of 1:100 (40x lens).")
![Knockout Validated: CHD1 Antibody [NBP3-02966] - Western blot analysis of extracts from normal (control) and CHD1 knockout (KO) 293T cells, using CHD1 antibody (NBP3-02966) at 1:500 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 90s.](http://images.novusbio.com/fullsize/CHD1-Antibody-Knockout-Validated-NBP3-02966-img0005.jpg "Knockout Validated: CHD1 Antibody [NBP3-02966] - Western blot analysis of extracts from normal (control) and CHD1 knockout (KO) 293T cells, using CHD1 antibody (NBP3-02966) at 1:500 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 90s.")
![Western Blot Brg1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Brg1_AF5738_Western_Blot_5829.jpg)
![Immunocytochemistry Brg1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Brg1_AF5738_Immunocytochemistry_11663.jpg)
![Immunocytochemistry Brg1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Brg1_AF5738_Immunocytochemistry_11664.jpg)
![Western Blot DSCAM Antibody [Unconjugated] - Long Isoform](https://images.novusbio.com/images2/DSCAM_AF3666_Western_Blot_21015.jpg)
![Immunocytochemistry DSCAM Antibody [Unconjugated] - Long Isoform](https://images.novusbio.com/images2/DSCAM_AF3666_Immunocytochemistry_6499.jpg)
![Western Blot DSCAM Antibody [Unconjugated] - Long Isoform](https://images.novusbio.com/images/af3666_human-dscam-affinity-purified-polyclonal-ab-22820241721154.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")