Home » CD117/c-kit » CD117/c-kit Proteins » CD117/c-kit Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

CD117/c-kit Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for CD117/c-kit Recombinant Protein Antigen (NBP2-57890PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

100% Guarantee on every product

CD117/c-kit Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CD117/c-kit.

Source: E. coli

Amino Acid Sequence: RKRDSFICSKQEDHAEAALYKNLLHSKESSCSDSTNEYMDMKPGVSYVVPTKADKRRSVRIGSYIERDVTPAIMEDDELAL

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
KIT
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-57890.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking tide related information and a protocol, click here.
Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for CD117/c-kit Recombinant Protein Antigen

  • CD117 antigen
  • CD117
  • ckit
  • c-kit
  • EC 2.7.10
  • EC 2.7.10.1
  • KIT
  • PBT
  • piebald trait
  • Proto-oncogene c-Kit
  • proto-oncogene tyrosine-protein kinase Kit
  • SCF R
  • SCFR
  • SCFRmast/stem cell growth factor receptor
  • soluble KIT variant 1
  • Tyrosine-protein kinase Kit
  • v-kit Hardy-Zuckerman 4 feline sarcoma viral oncogene homolog
  • v-kit Hardy-Zuckerman 4 feline sarcoma viral oncogene-like protein

Background

CD117 is a 145 kD immunoglobulin superfamily member, also known as c-Kit and stem cell factor receptor (SCFR). It is a transmembrane tyrosine-kinase receptor that binds the c-Kit ligand (also known as steel factor, stem cell factor, and mast cell growth factor). CD117 is expressed on hematopoietic stem cells (including multipotent hematopoietic stem cells, progenitors committed to myeloid and/or erythroid lineages, and T and B cell precursors), mast cells, and acute myeloid leukemia (AML) cells. CD117 interaction with it's ligand is critical for the development of hematopoietic stem cells. The 2B8 antibody does not block c-Kit activity.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

SCF/c-kit Ligand
[Unconjugated]
255-SC
SCF/c-kit Ligand [Unconjugated]
(194 Publications)
Species: Hu
Applications: BA
CD34 Antibody
[Unconjugated]
AF4117
Immunohistochemistry CD34 Antibody [Unconjugated]
(3 Reviews)
(37 Publications)
Species: Rt
Applications: IHC, WB
PDGFR alpha
Antibody [Unconjugate
AF1062
Western Blot PDGFR alpha Antibody [Unconjugated]
Immunohistochemistry PDGFR alpha Antibody [Unconjugated]
Neutralization PDGFR alpha Antibody [Unconjugated]
(4 Reviews)
(277 Publications)
Species: Mu
Applications: Flow, IHC, Neut, WB
TNF-alpha
[Unconjugated]
210-TA
SDS-PAGE TNF-alpha [Unconjugated]
Bioactivity TNF-alpha [Unconjugated]
SEC-MALS TNF-alpha [Unconjugated]
(3 Reviews)
(803 Publications)
Species: Hu
Applications: BA
Caspase-3 Antibody
[Unconjugated] - Acti ...
AF835
Immunocytochemistry Caspase-3 Antibody [Unconjugated] - Active
Immunohistochemistry Caspase-3 Antibody [Unconjugated] - Active
Immunocytochemistry Caspase-3 Antibody [Unconjugated] - Active
(7 Reviews)
(383 Publications)
Species: Hu, Mu
Applications: ICC, IHC
IL-6 [HRP]
M6000B
N/A IL-6 [HRP]
N/A IL-6 [HRP]
N/A IL-6 [HRP]
(631 Publications)
Species: Mu
Applications: ELISA
EGFR Antibody
[Unconjugated]
AF231
Immunohistochemistry EGFR Antibody [Unconjugated]
Immunocytochemistry EGFR Antibody [Unconjugated]
Western Blot EGFR Antibody [Unconjugated]
(30 Publications)
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
Flt-3/Flk-2/CD135
Antibody (66903) [Unc ...
MAB812
Flow Cytometry Flt-3/Flk-2/CD135 Antibody (66903) [Unconjugated]
Flow Cytometry Flt-3/Flk-2/CD135 Antibody (66903) [Unconjugated]
(4 Publications)
Species: Hu
Applications: CyTOF-ready, Flow
CTLA-4
[Unconjugated]
7268-CT
Bioactivity CTLA-4 [Unconjugated]
(3 Publications)
Species: Hu
Applications: BA
HLA DQ/DR/DP
Antibody (HLA-Pan/296 ...
NBP2-79843
Protein Array HLA DQ/DR/DP Antibody (HLA-Pan/2967R) - Azide and BSA Free
Immunocytochemistry/ Immunofluorescence HLA DQ/DR/DP Antibody (HLA-Pan/2967R) - Azide and BSA Free
Western Blot HLA DQ/DR/DP Antibody (HLA-Pan/2967R) - Azide and BSA Free
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
VEGF [HRP]
DVE00
N/A VEGF [HRP]
N/A VEGF [HRP]
N/A VEGF [HRP]
(672 Publications)
Species: Hu
Applications: ELISA
Desmin Antibody
AF3844
Immunohistochemistry Desmin Antibody
Immunohistochemistry Desmin Antibody
Immunocytochemistry/ Immunofluorescence Desmin Antibody
(2 Reviews)
(30 Publications)
Species: Hu, Mu
Applications: IHC
NOD2 Antibody
(2D9) - BSA Free
NB100-524
Flow Cytometry NOD2 Antibody (2D9) - BSA Free
Flow Cytometry NOD2 Antibody (2D9) - BSA Free
Immunohistochemistry-Frozen NOD2 Antibody (2D9) - BSA Free
(1 Review)
(26 Publications)
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
IL-3 [Unconjugated]
203-IL
SDS-PAGE IL-3 [Unconjugated]
Bioactivity IL-3 [Unconjugated]
SEC-MALS IL-3 [Unconjugated]
(204 Publications)
Species: Hu
Applications: BA
Vimentin Antibody
NB300-223
Immunocytochemistry/ Immunofluorescence Vimentin Antibody
Immunohistochemistry-Frozen Vimentin Antibody
Immunocytochemistry/ Immunofluorescence Vimentin Antibody
(6 Reviews)
(69 Publications)
Species: Bv, Ca, Ch, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
ErbB2/Her2
[Unconjugated]
1129-ER
SDS-PAGE ErbB2/Her2 [Unconjugated]
Bioactivity ErbB2/Her2 [Unconjugated]
(58 Publications)
Species: Hu
Applications: BA
CD45 Antibody
[Unconjugated]
AF114
Immunohistochemistry CD45 Antibody [Unconjugated]
Immunocytochemistry CD45 Antibody [Unconjugated]
Immunocytochemistry/ Immunofluorescence CD45 Antibody [Unconjugated]
(1 Review)
(63 Publications)
Species: Mu
Applications: CyTOF-ready, Flow, ICC, IHC, WB
p53 Antibody (PAb
240) - BSA Free
NB200-103
Flow Cytometry p53 Antibody (PAb 240) - BSA Free
Flow Cytometry p53 Antibody (PAb 240) - BSA Free
Flow (Intracellular) p53 Antibody (PAb 240) - BSA Free
(3 Reviews)
(39 Publications)
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
PDGF R beta
Antibody [Unconjugate
AF1042
Immunohistochemistry PDGF R beta Antibody [Unconjugated]
Western Blot PDGF R beta Antibody [Unconjugated]
Immunohistochemistry PDGF R beta Antibody [Unconjugated]
(101 Publications)
Species: Mu
Applications: Dual ISH-IHC, IHC, WB
CD117/c-kit
Recombinant Protein A
NBP2-57890PEP
CD117/c-kit Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for CD117/c-kit Recombinant Protein Antigen (NBP2-57890PEP) (0)

There are no publications for CD117/c-kit Recombinant Protein Antigen (NBP2-57890PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CD117/c-kit Recombinant Protein Antigen (NBP2-57890PEP) (0)

There are no reviews for CD117/c-kit Recombinant Protein Antigen (NBP2-57890PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for CD117/c-kit Recombinant Protein Antigen (NBP2-57890PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CD117/c-kit Products

Research Areas for CD117/c-kit Recombinant Protein Antigen (NBP2-57890PEP)

Find related products by research area.

Blogs on CD117/c-kit.

Check out the latest blog posts on CD117/c-kit.
Do you see what I see? I c-Kit
The c-Kit (CD117) proto-oncogene is a 145 kD receptor tyrosine kinase family closely related to platelet-derived growth factor receptor (PDGFR). It is a transmembrane receptor and the cellular homolog of the HZ4-feline sarcoma virus transforming gene ...  Read full blog post.

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
TNF-alpha [Unconjugated]
210-TA-005
Simple Western lane view shows lysates of MO7e human megakaryocytic leukemic cell line, P815 mouse mastocytoma cell line and MC/9-2 mouse mast cell line, loaded at 0.2 mg/mL. A specific band was detected for CD117/c-kit at approximately 150-165 kDa (as indicated) using 5 µg/mL of Goat Anti-Human/Mouse CD117/c-kit Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1356) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.        
CD117/c-kit Antibody [Unconjugated]
AF1356

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our CD117/c-kit Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol KIT