Novus Biologicals products are now on bio-techne.com

CD117/c-kit Recombinant Protein Antigen

Images

 
There are currently no images for CD117/c-kit Recombinant Protein Antigen (NBP2-52975PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

CD117/c-kit Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CD117/c-kit.

Source: E. coli

Amino Acid Sequence: VGDEIRLLCTDPGFVKWTFEILDETNENKQNEWITEKAEATNTGKYTCTNKHGLSNSIYVFVRDPAKLFLVDRSLYGKEDNDTLVRCPLTDPEVTNYSLKGCQGKPLPKDLRFIPDPKAGIMIKSVKRAYHRLCLHCSVDQ

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
KIT
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52975.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking tide related information and a protocol, click here.

Theoretical MW
34 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for CD117/c-kit Recombinant Protein Antigen

  • CD117 antigen
  • CD117
  • ckit
  • c-kit
  • EC 2.7.10
  • EC 2.7.10.1
  • KIT
  • PBT
  • piebald trait
  • Proto-oncogene c-Kit
  • proto-oncogene tyrosine-protein kinase Kit
  • SCF R
  • SCFR
  • SCFRmast/stem cell growth factor receptor
  • soluble KIT variant 1
  • Tyrosine-protein kinase Kit
  • v-kit Hardy-Zuckerman 4 feline sarcoma viral oncogene homolog
  • v-kit Hardy-Zuckerman 4 feline sarcoma viral oncogene-like protein

Background

CD117 is a 145 kD immunoglobulin superfamily member, also known as c-Kit and stem cell factor receptor (SCFR). It is a transmembrane tyrosine-kinase receptor that binds the c-Kit ligand (also known as steel factor, stem cell factor, and mast cell growth factor). CD117 is expressed on hematopoietic stem cells (including multipotent hematopoietic stem cells, progenitors committed to myeloid and/or erythroid lineages, and T and B cell precursors), mast cells, and acute myeloid leukemia (AML) cells. CD117 interaction with it's ligand is critical for the development of hematopoietic stem cells. The 2B8 antibody does not block c-Kit activity.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

255-SC
Species: Hu
Applications: BA
AF4117
Species: Rt
Applications: IHC, WB
AF1062
Species: Mu
Applications: Flow, IHC, Neut, WB
M6000B
Species: Mu
Applications: ELISA
AF231
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
MAB812
Species: Hu
Applications: CyTOF-ready, Flow
7268-CT
Species: Hu
Applications: BA
NBP2-79843
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
DVE00
Species: Hu
Applications: ELISA
AF3844
Species: Hu, Mu
Applications: IHC
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
203-IL
Species: Hu
Applications: BA
NB300-223
Species: Bv, Ca, Ch, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
1129-ER
Species: Hu
Applications: BA
AF114
Species: Mu
Applications: CyTOF-ready, Flow, ICC, IHC, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
AF1042
Species: Mu
Applications: Dual ISH-IHC, IHC, WB
NBP2-52975PEP
Species: Hu
Applications: AC

Publications for CD117/c-kit Recombinant Protein Antigen (NBP2-52975PEP) (0)

There are no publications for CD117/c-kit Recombinant Protein Antigen (NBP2-52975PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CD117/c-kit Recombinant Protein Antigen (NBP2-52975PEP) (0)

There are no reviews for CD117/c-kit Recombinant Protein Antigen (NBP2-52975PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for CD117/c-kit Recombinant Protein Antigen (NBP2-52975PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CD117/c-kit Products

Research Areas for CD117/c-kit Recombinant Protein Antigen (NBP2-52975PEP)

Find related products by research area.

Blogs on CD117/c-kit.

Do you see what I see? I c-Kit
The c-Kit (CD117) proto-oncogene is a 145 kD receptor tyrosine kinase family closely related to platelet-derived growth factor receptor (PDGFR). It is a transmembrane receptor and the cellular homolog of the HZ4-feline sarcoma virus transforming gene ...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our CD117/c-kit Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol KIT