The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
Immunogen
Synthetic peptide directed towards the middle region of human CCL18. Peptide sequence PQKFIVDYSETSPQCPKPGVILLTKRGRQICADPNKKWVQKYISDLKLNA. The peptide sequence for this immunogen was taken from within the described region.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CCL18
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
10 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Publications
Read Publications using NBP1-79940 in the following applications:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Concentration
0.5 mg/ml
Purity
Affinity purified
Alternate Names for CCL18/PARC Antibody
Alternative macrophage activation-associated CC chemokine 1
AMAC-1
AMAC1CC chemokine ligand 18
AMAC-1Small-inducible cytokine A18
CCL18
chemokine (C-C motif) ligand 18 (pulmonary and activation-regulated)
CKb7
DC-CK1
DC-CK1CC chemokine PARC
DCCK1Macrophage inflammatory protein 4
Dendritic cell chemokine 1
MIP4
MIP-4
MIP-4C-C motif chemokine 18
PARC
PARCPulmonary and activation-regulated chemokine
SCYA18chemokine (C-C), dendritic
small inducible cytokine A18
small inducible cytokine subfamily A (Cys-Cys), member 18, pulmonary andactivation-regulated
Background
CCL18 - chemokine (C-C motif) ligand 18 (pulmonary and activation-regulated)
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
FAQs for CCL18/PARC Antibody (NBP1-79940). (Showing 1 - 1 of 1 FAQs).
One customer is interested in that Ab: Macrophage Inflammatory Protein 4 Antibody - NBP1-79940 Please, I will be very grateful if you indicate me: - The concentration of the current lot. - Do you have previously news about the use of this Ab in IHC-P with human lung and arterial tissue samples?. Also, any recent bibliographic publication?. - Which other positive control, apart intestinal tissue, you recommend for IHC-P?. - Which detection system you recommend for IHC-P for that Ab?, which is it the exactlly one that you have employed at the image the image that you have at the data sheet?-
Thank you very much for your kind note and for sharing your customer's query on our Macrophage Inflammatory Protein 4 antibody (NBP1-79940). The point wise answer to your query is as follows: Q1. The concentration of the current lot. Answer: This product is sold in its lyophilized form and the concentration will not be relevant to the vial. The unit size is 0.05 mg and the customer can reconstitute the vial as: centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50ul of distilled water. Vortex followed by centrifuge again to pellet the solution. Final concentration is 1 mg/ml in PBS buffer. Q2. Do you have previously news about the use of this Ab in IHC-P with human lung and arterial tissue samples?. Also, any recent bibliographic publication?. Answer: No, we do not know of anyone citing this product yet, and we do not have any customer feedback on your mentioned tissues. Lung is one of the tissues where this target is expressed well, and we are confident that the antibody will detect the protein in lung sections. Q3. Which other positive control, apart intestinal tissue, you recommend for IHC-P?. Answer: From Uniprot, we can see that lung, lymph nodes, placenta or bone marrow would be of great choice as positive controls. Further, the customer may look at the following papers to see how other researchers performed Macrophage Inflammatory Protein 4 (CCL18) staining in different tissues: PMID 24011266, PMID 23433718, and PMID 11590198. Q4. Which detection system you recommend for IHC-P for that Ab?, which is it the exactlly one that you have employed at the image the image that you have at the data sheet? Answer: DAB based detection system was used for the final development of the staining.
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
=
÷
Review this Product
Be the first to review our CCL18/PARC Antibody and receive a gift card or discount.