Reactivity | HuSpecies Glossary |
Applications | WB, Flow |
Clonality | Polyclonal |
Host | Rabbit |
Conjugate | Unconjugated |
Concentration | 0.5 mg/ml |
Description | The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution. |
Immunogen | Synthetic peptides corresponding to CASP5 (caspase 5, apoptosis-related cysteine peptidase) The peptide sequence was selected form the middle region of CASP5. Peptide sequence VIIVQACRGEKHGELWVRDSPASLALISSQSSENLEADSVCKIHEEKDFI. The peptide sequence for this immunogen was taken from within the described region. |
Isotype | IgG |
Clonality | Polyclonal |
Host | Rabbit |
Gene | CASP5 |
Purity | Affinity purified |
Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
Dilutions |
|
||
Control |
|
Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer | PBS, 2% Sucrose |
Preservative | 0.09% Sodium Azide |
Concentration | 0.5 mg/ml |
Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for Caspase 5 Antibody (NBP1-69200)Find related products by research area.
|
CARD & NFKB Antibodies for Apoptosis Research Apoptosis is one of the main types of programmed cell death which involves a cascade of biochemical events leading to specific cell morphology characteristics and ultimately death of cells.Caspases play crucial roles in modulating cellular signaling... Read full blog post. |
Caspase Antibodies as Cancer Biomarkers We at Novus Biologicals are one of the leading antibody suppliers for products targeted to apoptosis. These products are regularly used by cancer research groups - apoptosis is fundamental to developing therapies that will kill tumor cells. Caspase pr... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
Gene Symbol | CASP5 |
OMIM |
|