![Western Blot: CRTAP Antibody (4D9) [H00010491-M01] - CRTAP monoclonal antibody (M01), clone 4D9 Analysis of CRTAP expression in HeLa.](http://images.novusbio.com/fullsize/CRTAP-Antibody-4D9-Western-Blot-H00010491-M01-img0007.jpg "Western Blot: CRTAP Antibody (4D9) [H00010491-M01] - CRTAP monoclonal antibody (M01), clone 4D9 Analysis of CRTAP expression in HeLa.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ELISA, IHC |
| Clone | 4D9 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Immunogen | CRTAP (NP_006362, 307 a.a. ~ 401 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. KLNDLKNAAPCAVSYLLFDQNDKVMQQNLVYYQYHRDTWGLSDEHFQPRPEAVQFFNVTTLQKELYDFAKENIMDDDEGEVVEYVDDLLELEETS |
| Specificity | CRTAP (4D9) |
| Isotype | IgG2a Kappa |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | CRTAP |
| Purity | Protein A purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunohistochemistry (paraffin) and ELISA. |
||
| Control |
|
||
| Publications |
|
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | In 1x PBS, pH 7.4 |
| Preservative | No Preservative |
| Purity | Protein A purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for CRTAP Antibody (H00010491-M01)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunohistochemistry-Paraffin: CRTAP Antibody (4D9) [H00010491-M01] - Analysis of monoclonal antibody to CRTAP on formalin-fixed paraffin-embedded human kidney. Antibody concentration 3 ug/ml.](http://images.novusbio.com/fullsize/CRTAP-Antibody-4D9-Immunohistochemistry-Paraffin-H00010491-M01-img0005.jpg "Immunohistochemistry-Paraffin: CRTAP Antibody (4D9) [H00010491-M01] - Analysis of monoclonal antibody to CRTAP on formalin-fixed paraffin-embedded human kidney. Antibody concentration 3 ug/ml.")
![Sandwich ELISA: CRTAP Antibody (4D9) [H00010491-M01] - Detection limit for recombinant GST tagged CRTAP is approximately 0.03ng/ml as a capture antibody.](http://images.novusbio.com/fullsize/CRTAP-Antibody-4D9-Sandwich-ELISA-H00010491-M01-img0006.jpg "Sandwich ELISA: CRTAP Antibody (4D9) [H00010491-M01] - Detection limit for recombinant GST tagged CRTAP is approximately 0.03ng/ml as a capture antibody.")
![Immunocytochemistry Caspase-3 Antibody [Unconjugated] - Active](https://images.novusbio.com/images2/Caspase-3_AF835_Immunocytochemistry_6532.jpg)
![Immunohistochemistry Caspase-3 Antibody [Unconjugated] - Active](https://images.novusbio.com/images2/Caspase3_AF835_Immunohistochemistry_22976.jpg)
![Immunocytochemistry Caspase-3 Antibody [Unconjugated] - Active](https://images.novusbio.com/images2/Caspase-3_AF835_Immunocytochemistry_9340.jpg)
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
