Brachyury Antibody Summary
Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: QQPGYSQWGWLLPGTSTLCPPANPHPQFGGALSLPSTHSCDRYPTLRSHRSSPYPSPYAHRNNSPTYSDNSPACLSMLQSHDNWSSLGMPAHPSMLPVSHNASPPTSSSQY |
Marker |
Mesoderm Marker |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
TBXT |
Purity |
Immunogen affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
|
Application Notes |
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
Control Peptide |
|
Reactivity Notes
Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (85%), Rat (87%)
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer |
PBS (pH 7.2) and 40% Glycerol |
Preservative |
0.02% Sodium Azide |
Purity |
Immunogen affinity purified |
Alternate Names for Brachyury Antibody
Background
Brachyury / Bry is encoded by this gene is an embryonic nuclear transcription factor that binds to a specific DNA element, the palindromic T-site. It binds through a region in its N-terminus, called the T-box, and effects transcription of genes required for mesoderm formation and differentiation. The protein is localized to notochord-derived cells.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: BA, BA
Species: Hu
Applications: BA
Species: Hu, Mu
Applications: ChIP, ICC, IP, Simple Western, WB
Species: Hu, Mu
Applications: BA
Species: Hu
Applications: ICC/IF, IHC, IP, WB
Species: Hu
Applications: ICC, WB
Species: Ca, Fe, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu
Applications: BA
Species: Hu
Applications: BA
Species: Hu
Applications: ChIP, ICC, IHC, WB
Species: Mu
Applications: CyTOF-ready, Dual ISH-IHC, Flow, IHC, Neut, WB
Species: Hu, Mu, Rt
Applications: ChIP, CyTOF-ready, ICC, IHC, ICFlow, Simple Western, WB
Species: Bv
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, RIA, RI, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: CyTOF-ready, ICC, ICFlow, WB
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Publications for Brachyury Antibody (NBP1-87598) (0)
There are no publications for Brachyury Antibody (NBP1-87598).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Brachyury Antibody (NBP1-87598) (0)
There are no reviews for Brachyury Antibody (NBP1-87598).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Brachyury Antibody (NBP1-87598) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Brachyury Products
Research Areas for Brachyury Antibody (NBP1-87598)
Find related products by research area.
|
Blogs on Brachyury