BMI-1 Recombinant Protein Antigen

Images

 
There are currently no images for BMI-1 Recombinant Protein Antigen (NBP2-57552PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

BMI-1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human BMI-1.

Source: E. coli

Amino Acid Sequence: SLSIEFFDQNRLDRKVNKDKEKSKEEVNDKRYLRCPAAMTVMHLRKFLRSKMDIPNTFQIDVMYE

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
BMI1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-57552.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for BMI-1 Recombinant Protein Antigen

  • B lymphoma Mo-MLV insertion region 1 homolog (mouse)
  • B lymphoma Mo-MLV insertion region 1 homolog
  • BMI1 polycomb ring finger oncogene
  • BMI1
  • BMI-1
  • FLVI2/BMI1
  • MGC12685
  • murine leukemia viral (bmi-1) oncogene homolog
  • PCGF4
  • polycomb complex protein BMI-1
  • polycomb group protein Bmi1
  • polycomb group ring finger 4
  • RING finger protein 51
  • RNF51
  • RNF51Polycomb group RING finger protein 4

Background

Bmi1 polycomb ring finger oncogene regulates the cell cycle inhibitor genes p16 and p19, with implications in hematopoiesis, skeletal patterning, neurological functions, and development of the cerebellum. Bmi 1 has been shown to induce telomerase activity and immortalize human mammary epithelial cells, and extend the replicative life span of human fibroblasts by suppressing the p16-dependent senescence pathway. Bmi-1 is also required for efficient self-renewing cell division in adult hematopoietic and neural stem cells.

Aberrant expression of Bmi-1 has been found in several types of cancer in the bladder, skin, blood, prostate, breast, ovaries, andcolon. Its overexpression is especially pronounced in mantle cell lymphomas. Thereforem Bmi1 antibodies will be useful tools for many cancer development studies.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-106
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP1-96140
Species: Hu, Mu
Applications: ChIP, Flow-IC, Flow, ICC/IF, IP, WB
AF4767
Species: Hu, Mu
Applications: ICC, WB
NB600-302
Species: Bv, Dr, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, S-ELISA, Simple Western, WB
NBP1-88856
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NB100-1240
Species: Hu
Applications: PEP-ELISA, WB
H00006045-M01
Species: Hu, I, Mu
Applications: ELISA, ICC/IF, KD, S-ELISA, WB
NBP1-80830
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
AF1759
Species: Hu, Mu
Applications: ChIP, ICC, IP, Simple Western, WB
NBP2-29463
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NB100-317
Species: Hu, Mu, Rt
Applications: ChIP, ChIP, Flow, ICC/IF, IHC, IHC-P, IP, WB
NB120-16518
Species: Hu, Mu, Po, Rt
Applications: ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
7268-CT
Species: Hu
Applications: BA
NBP2-57552PEP
Species: Hu
Applications: AC

Publications for BMI-1 Recombinant Protein Antigen (NBP2-57552PEP) (0)

There are no publications for BMI-1 Recombinant Protein Antigen (NBP2-57552PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BMI-1 Recombinant Protein Antigen (NBP2-57552PEP) (0)

There are no reviews for BMI-1 Recombinant Protein Antigen (NBP2-57552PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for BMI-1 Recombinant Protein Antigen (NBP2-57552PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional BMI-1 Products

Research Areas for BMI-1 Recombinant Protein Antigen (NBP2-57552PEP)

Find related products by research area.

Blogs on BMI-1

There are no specific blogs for BMI-1, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our BMI-1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol BMI1