![Western Blot: BLOC1S2 Antibody [NBP2-87075] - WB Suggested Anti-Bloc1s2 Antibody. Titration: 1.0 ug/ml. Positive Control: Mouse Heart](http://images.novusbio.com/fullsize/BLOC1S2-Antibody-Western-Blot-NBP2-87075-img0001.jpg "Western Blot: BLOC1S2 Antibody [NBP2-87075] - WB Suggested Anti-Bloc1s2 Antibody. Titration: 1.0 ug/ml. Positive Control: Mouse Heart")
| Reactivity | MuSpecies Glossary |
| Applications | WB |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Concentration | 0.5 mg/ml |
| Immunogen | The immunogen is a synthetic peptide directed towards the N-terminal region of BLOC1S2. Peptide sequence: KEPAEADINELCRDMFSKMATYLTGELTATSEDYKLLENMNKLTSLKYLE The peptide sequence for this immunogen was taken from within the described region. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | BLOC1S2 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS, 2% Sucrose |
| Preservative | 0.09% Sodium Azide |
| Concentration | 0.5 mg/ml |
| Purity | Affinity purified |
![Immunohistochemistry Neurophysin II/Arg-vasopressin Antibody [Unconjugated]](https://images.novusbio.com/images/antibody/af009_human-neurophysin-ii-affinity-purified-polyclonal-ab-immunohistochemistry-2812202013195.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for BLOC1S2 Antibody (NBP2-87075)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | BLOC1S2 |
![N/A Complement Component C5a [Biotin]](https://images.novusbio.com/images2/DATA_Complement_Component_C5a_DY2037_ELISA_1753.jpg)
![SDS-PAGE PDGF-BB [Unconjugated]](https://images.novusbio.com/images2/PDGF-BB_220-BB_290.jpg)
![Bioactivity PDGF-BB [Unconjugated]](https://images.novusbio.com/images2/PDGF-BB_220-BB_291.jpg)
![Western Blot IFN-alpha/beta R1 Antibody [Unconjugated]](https://images.novusbio.com/images2/af245_mouse-tsp50-affinity-purified-polyclonal-ab-western-blot-672022104711.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")