![Immunohistochemistry-Paraffin: BCAS1 Antibody [NBP2-38736] - Analysis in human prostate and skeletal muscle tissues using NBP2-38736 antibody. Corresponding BCAS1 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/BCAS1-Antibody-Immunohistochemistry-Paraffin-NBP2-38736-img0011.jpg "Immunohistochemistry-Paraffin: BCAS1 Antibody [NBP2-38736] - Analysis in human prostate and skeletal muscle tissues using NBP2-38736 antibody. Corresponding BCAS1 RNA-seq data are presented for the same tissues.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: PSKPKDSSFFDKFFKLDKGQEKVPGDSQQEAKRAEHQDKVDEVPGLSGQSDDVPAGKDIVDGKEKEGQELGTADCSVPGDPEGLETAKDDSQ |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | BCAS1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for BCAS1 Antibody (NBP2-38736)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunohistochemistry-Paraffin: BCAS1 Antibody [NBP2-38736] - Staining of human cerebral cortex, colon, prostate and testis using Anti-BCAS1 antibody NBP2-38736 (A) shows similar protein distribution across tissues to independent antibody NBP2-38658 (B).](http://images.novusbio.com/fullsize/BCAS1-Antibody-Immunohistochemistry-Paraffin-NBP2-38736-img0008.jpg "Immunohistochemistry-Paraffin: BCAS1 Antibody [NBP2-38736] - Staining of human cerebral cortex, colon, prostate and testis using Anti-BCAS1 antibody NBP2-38736 (A) shows similar protein distribution across tissues to independent antibody NBP2-38658 (B).")
![Western Blot: BCAS1 Antibody [NBP2-38736] - Analysis in human cerebral cortex tissue.](http://images.novusbio.com/fullsize/BCAS1-Antibody-Western-Blot-NBP2-38736-img0015.jpg "Western Blot: BCAS1 Antibody [NBP2-38736] - Analysis in human cerebral cortex tissue.")
![Immunocytochemistry/Immunofluorescence: BCAS1 Antibody [NBP2-38736] - Staining of human cell line MCF7 shows localization to vesicles. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/BCAS1-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-38736-img0003.jpg "Immunocytochemistry/Immunofluorescence: BCAS1 Antibody [NBP2-38736] - Staining of human cell line MCF7 shows localization to vesicles. Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: BCAS1 Antibody [NBP2-38736] - Staining of human skeletal muscle shows no positivity in myocytes as expected.](http://images.novusbio.com/fullsize/BCAS1-Antibody-Immunohistochemistry-Paraffin-NBP2-38736-img0014.jpg "Immunohistochemistry-Paraffin: BCAS1 Antibody [NBP2-38736] - Staining of human skeletal muscle shows no positivity in myocytes as expected.")
![Immunohistochemistry-Paraffin: BCAS1 Antibody [NBP2-38736] - Staining of human cerebral cortex.](http://images.novusbio.com/fullsize/BCAS1-Antibody-Immunohistochemistry-Paraffin-NBP2-38736-img0009.jpg "Immunohistochemistry-Paraffin: BCAS1 Antibody [NBP2-38736] - Staining of human cerebral cortex.")
![Immunohistochemistry-Paraffin: BCAS1 Antibody [NBP2-38736] - Staining of human prostate shows strong cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/BCAS1-Antibody-Immunohistochemistry-Paraffin-NBP2-38736-img0012.jpg "Immunohistochemistry-Paraffin: BCAS1 Antibody [NBP2-38736] - Staining of human prostate shows strong cytoplasmic positivity in glandular cells.")
![Immunohistochemistry-Paraffin: BCAS1 Antibody [NBP2-38736] - Staining of human colon shows strong cytoplasmic psotivity in glandular cells.](http://images.novusbio.com/fullsize/BCAS1-Antibody-Immunohistochemistry-Paraffin-NBP2-38736-img0013.jpg "Immunohistochemistry-Paraffin: BCAS1 Antibody [NBP2-38736] - Staining of human colon shows strong cytoplasmic psotivity in glandular cells.")
![Intracellular Staining by Flow Cytometry EMP3 Antibody (439949) [Unconjugated]](https://images.novusbio.com/images2/EMP3_MAB4505_Flow_Cytometry_8469.jpg)
![Intracellular Staining by Flow Cytometry EMP3 Antibody (439949) [Unconjugated]](https://images.novusbio.com/images/antibody/mab4505_human-emp3-mab-clone-439949-intracellular-staining-by-flow-cytometry-1782023142644.jpg)
![SDS-PAGE ErbB2/Her2 [Unconjugated]](https://images.novusbio.com/images2/ErbB2_1129-ER_70.jpg)
![Bioactivity ErbB2/Her2 [Unconjugated]](https://images.novusbio.com/images2/1129-er_recombinant-human-erbb2-her2-fc-chimera-protein-cf-bioactivity-7122020142841.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")