![Immunocytochemistry/ Immunofluorescence: AKR1C2 Antibody [NBP3-35145] - Immunofluorescence analysis of L929 cells using AKR1C2 Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/nbp3-35145_rabbit-akr1c2-pab-1012202411343318.jpg "Immunocytochemistry/ Immunofluorescence: AKR1C2 Antibody [NBP3-35145] - Immunofluorescence analysis of L929 cells using AKR1C2 Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ELISA, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-323 of human AKR1C2 (NP_995317.1). Sequence: MDSKYQCVKLNDGHFMPVLGFGTYAPAEVPKSKALEAVKLAIEAGFHHIDSAHVYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSNSHRPELVRPALERSLKNLQLDYVDLYLIHFPVSVKPGEEVIPKDENGKILFDTVDLCATWEAMEKCKDAGLAKSIGVSNFNHRLLEMILNKPGLKYKPVCNQVECHPYFNQRKLLDFCKSKDIVLVAYSALGSHREEPWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTSEEMKAIDGLNRNVRYLTLDIFAGPPNYPFSDEY |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | AKR1C2 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Theoretical MW | 37 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.3), 50% glycerol |
| Preservative | 0.05% Proclin 300 |
| Purity | Affinity purified |
![Immunohistochemistry ACE/CD143 Antibody [Unconjugated]](https://images.novusbio.com/images2/ACE_AF1513_Immunohistochemistry_6703.jpg)
![Western Blot ACE/CD143 Antibody [Unconjugated]](https://images.novusbio.com/images2/ACE_AF1513_Flow_Cytometry_20028.jpg)
![Simple Western ACE/CD143 Antibody [Unconjugated]](https://images.novusbio.com/images2/ACE_AF1513_Simple_Western_20109.jpg)
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | AKR1C2 |
![Western Blot: AKR1C2 Antibody [NBP3-35145] - Western blot analysis of various lysates, using AKR1C2 Rabbit pAb at 1:2000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 10s.](http://images.novusbio.com/fullsize/nbp3-35145_rabbit-akr1c2-pab-1012202411421018.jpg "Western Blot: AKR1C2 Antibody [NBP3-35145] - Western blot analysis of various lysates, using AKR1C2 Rabbit pAb at 1:2000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 10s.")
![Immunohistochemistry: AKR1C2 Antibody [NBP3-35145] - Immunohistochemistry analysis of paraffin-embedded Human Colon cancer using AKR1C2 Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.](http://images.novusbio.com/fullsize/nbp3-35145_rabbit-akr1c2-pab-1012202411334036.jpg "Immunohistochemistry: AKR1C2 Antibody [NBP3-35145] - Immunohistochemistry analysis of paraffin-embedded Human Colon cancer using AKR1C2 Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.")
![Immunocytochemistry/ Immunofluorescence: AKR1C2 Antibody [NBP3-35145] - Immunofluorescence analysis of U-2 OS cells using AKR1C2 Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/nbp3-35145_rabbit-akr1c2-pab-1012202411334076.jpg "Immunocytochemistry/ Immunofluorescence: AKR1C2 Antibody [NBP3-35145] - Immunofluorescence analysis of U-2 OS cells using AKR1C2 Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.")
![Immunohistochemistry: AKR1C2 Antibody [NBP3-35145] - Immunohistochemistry analysis of paraffin-embedded Mouse liver using AKR1C2 Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.](http://images.novusbio.com/fullsize/nbp3-35145_rabbit-akr1c2-pab-1012202411421024.jpg "Immunohistochemistry: AKR1C2 Antibody [NBP3-35145] - Immunohistochemistry analysis of paraffin-embedded Mouse liver using AKR1C2 Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.")
![Immunohistochemistry: AKR1C2 Antibody [NBP3-35145] - Immunohistochemistry analysis of paraffin-embedded Human liver cancer using AKR1C2 Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.](http://images.novusbio.com/fullsize/nbp3-35145_rabbit-akr1c2-pab-1012202411381260.jpg "Immunohistochemistry: AKR1C2 Antibody [NBP3-35145] - Immunohistochemistry analysis of paraffin-embedded Human liver cancer using AKR1C2 Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.")
![Immunohistochemistry: AKR1C2 Antibody [NBP3-35145] - Immunohistochemistry analysis of paraffin-embedded Rat liver using AKR1C2 Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.](http://images.novusbio.com/fullsize/nbp3-35145_rabbit-akr1c2-pab-1012202411433424.jpg "Immunohistochemistry: AKR1C2 Antibody [NBP3-35145] - Immunohistochemistry analysis of paraffin-embedded Rat liver using AKR1C2 Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.")
![Western Blot ID1 Antibody [Unconjugated]](https://images.novusbio.com/images2/ID1_AF4377_Western_Blot_5453.jpg)
![Immunocytochemistry ID1 Antibody [Unconjugated]](https://images.novusbio.com/images2/ID1_AF4377_Immunocytochemistry_12849.jpg)
![Simple Western ID1 Antibody [Unconjugated]](https://images.novusbio.com/images2/af4377_human-mouse-id1-affinity-purified-polyclonal-ab-simple-western-482021152036.jpg)
![SDS-PAGE LIGHT/TNFSF14 [Unconjugated]](https://images.novusbio.com/images2/LIGHT_664-LI_719.jpg)
![Bioactivity LIGHT/TNFSF14 [Unconjugated]](https://images.novusbio.com/images2/LIGHT_664-LI_721.jpg)
![Simple Western Aldo-keto Reductase 1C1/AKR1C1 Antibody (859026) [Unconjugated]](https://images.novusbio.com/images2/Aldoketo_Reductase_1C1_MAB6529_Simple_Western_17147.jpg)
![Western Blot Aldo-keto Reductase 1C1/AKR1C1 Antibody (859026) [Unconjugated]](https://images.novusbio.com/images2/Aldoketo_Reductase_1C1_MAB6529_Western_Blot_13068.jpg)
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![N/A t-Plasminogen Activator/tPA [HRP]](https://images.novusbio.com/images2/DATA_tPlasminogen_Activator_DTPA00_ELISA_854.jpg)
![N/A t-Plasminogen Activator/tPA [HRP]](https://images.novusbio.com/images2/tPlasminogen_Activator_DTPA00_ELISA_510.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")