Novus Biologicals products are now on bio-techne.com

ATPB Recombinant Protein Antigen

Name: ATPB Recombinant Protein Antigen
Brand: Novus Biologicals
SKU: NBP1-90816PEP
Price: 279 USD

Images

There are currently no images for ATPB Protein (NBP1-90816PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary

Reactivity	HuSpecies Glossary
Applications	AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

ATPB Recombinant Protein Antigen Summary

Description	A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ATP5B. Source: E. coli Amino Acid Sequence: TSPSPKAGAATGRIVAVIGAVVDVQFDEGLPPILNALEVQGRETRLVLEVAQHLGESTVRTIAMDGTEGLVRGQKVLDSGAPIKIPVGPETLGRIMNVIGEPIDERGPIKTKQFAPIHAEAPEFMEMSVEQEILVTGIKVVD Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source	E. coli
Protein/Peptide Type	Recombinant Protein Antigen
Gene	ATP5F1B
Purity	>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions	Antibody Competition 10 - 100 molar excess
Application Notes	This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-90816. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com
Theoretical MW	33 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage	Store at -20C. Avoid freeze-thaw cycles.
Buffer	PBS and 1M Urea, pH 7.4.
Preservative	No Preservative
Purity	>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for ATPB Recombinant Protein Antigen

ATP synthase subunit beta, mitochondrial
ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide
ATPMB
ATPSBmitochondrial ATP synthase beta subunit
EC 3.6.3
EC 3.6.3.14
MGC5231
mitochondrial ATP synthetase, beta subunit

Background

ATP synthase is extremely conserved through evolution and can be found in plants, fungi, bacteria, and animals. The ATP synthase enzyme is a transmembrane protein responsible for driving the reversible reaction from ADP+ phosphate to ATP. This reaction is accomplished by a flux of protons across the membrane as a result of electron transfer. The ATP synthase protein has two main sections; the F1 ATP-ase (soluble) and the F0 ATP-ase (membrane embedded). The F1 section consists of the alpha, beta, gamma, delta, and epsilon subunits. While the F0 consists of a, b, and c subunits.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

GAPDH Antibody
(1D4)

NB300-221

Immunocytochemistry/ Immunofluorescence GAPDH Antibody (1D4)

(19 Reviews)

(431 Publications)

Species: Av, Bv, Ca, Ch, ChHa, Dr, Eq, Fe, Ha, Hu, Mu, Ma-Op, Po, Pm, Rb, Rt, Sh, Ze

Applications: ChIP, ICC/IF, IHC, IHC-Fr, IP, KD, Simple Western, Single-Cell Western, WB

Actin Gamma 1
Antibody

NB600-533

(6 Publications)

Species: Hu, Mu

Applications: Flow, ICC/IF, IHC, IP, Simple Western, WB

beta-Actin
Antibody (AC-15)

NB600-501

Simple Western beta-Actin Antibody (AC-15)

(27 Reviews)

(595 Publications)

Species: Bv, Ca, Ch, Dr(-), Fe, Fi, Gp, Ha, Hu, Le, Ma, Mu, Po, Pm, Rb, Rt, Sh, Sq, Tr, Ze

Applications: ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, KO, Simple Western, WB

Vimentin Antibody

NB300-223

Immunohistochemistry-Frozen Vimentin Antibody

(6 Reviews)

(70 Publications)

Species: Bv, Ca, Ch, Eq, Hu, Mu, Po, Rt

Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB

SDHA Antibody
(GT20710)

NBP3-13522

Immunocytochemistry/ Immunofluorescence SDHA Antibody (GT20710)

Species: Hu, Mu, Rt

Applications: ICC/IF, IHC, IHC-P, WB

14-3-3 zeta
Antibody (818515) [Un ...

MAB2669

Western Blot 14-3-3 zeta Antibody (818515) [Unconjugated]

Immunohistochemistry 14-3-3 zeta Antibody (818515) [Unconjugated]

(2 Reviews)

(1 Publication)

Species: Hu

Applications: IHC, Simple Western, WB

CYC1 Antibody

NBP1-86872

Immunohistochemistry-Paraffin CYC1 Antibody

(1 Review)

(7 Publications)

Species: Hu, Mu, Rt

Applications: ICC/IF, IHC, IHC-P, WB

beta-Actin
Antibody (AC-15)

NB600-501

(27 Reviews)

(595 Publications)

Species: Bv, Ca, Ch, Dr(-), Fe, Fi, Gp, Ha, Hu, Le, Ma, Mu, Po, Pm, Rb, Rt, Sh, Sq, Tr, Ze

Applications: ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, KO, Simple Western, WB

Cyclin I Antibody

NBP2-34060

Immunocytochemistry/ Immunofluorescence Cyclin I Antibody

Species: Hu

Applications: ICC/IF, IHC, IHC-P

Cytochrome C
Oxidase subunit 6c An ...

NBP2-45645

Immunohistochemistry Cytochrome C Oxidase subunit 6c Antibody (OTI4B11)

Species: Hu

Applications: ICC/IF, IHC, IHC-P, WB

Ubiquitin
[Unconjugated]

U-100H

(139 Publications)

Species: Hu

Applications: EnzAct

Ubiquitin C
Antibody - BSA Free

NBP2-94633

Species: Hu, Mu, Rt

Applications: ICC/IF, IHC, IHC-P, WB

Ubiquitin Antibody
(Ubi-1)

NB300-130

Immunocytochemistry/ Immunofluorescence Ubiquitin Antibody (Ubi-1)

(4 Reviews)

(49 Publications)

Species: Bv, Ce, Ch, Dr, Eq, Hu, Pm, Mu, Pl, Po, Rt, Ze

Applications: IB, ICC/IF, IHC, IHC-Fr, IHC-P, WB

TIAL1 Antibody

NBP1-79932

Immunocytochemistry/ Immunofluorescence TIAL1 Antibody

(4 Publications)

Species: Hu, Ze

Applications: ICC/IF, ISH, WB

mtTFA Antibody
(18G102B2E11)

NBP1-71648

Knockdown Validated mtTFA Antibody (18G102B2E11)

(2 Reviews)

(19 Publications)

Species: Hu, Mu, Rt

Applications: ICC/IF, IHC, IHC-P, KD, KO, Simple Western, WB

Caveolin-1
Antibody (7C8)

NB100-615

Immunocytochemistry/ Immunofluorescence Caveolin-1 Antibody (7C8)

(3 Reviews)

(37 Publications)

Species: Hu, Mu, Rt, Sh

Applications: Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB

Nrf2 Antibody

NBP1-32822

(4 Reviews)

(71 Publications)

Species: Al, Av, Hu, Mu, Pl, Rt, Ze

Applications: ChIP, Flow, ICC/IF, IHC, IHC-P, IP, KD, Simple Western, WB

GRP75/HSPA9B/Mortalin

NBP1-47801

Immunocytochemistry/ Immunofluorescence GRP75/HSPA9B/Mortalin Antibody (OTI9F8)

(1 Publication)

Species: Ca, Hu, Pm, Mu, Pm, Rt

Applications: Flow, ICC/IF, IHC, IHC-P, WB

GRP78/HSPA5
Antibody - BSA Free

NBP1-06274

Immunocytochemistry/ Immunofluorescence GRP78/HSPA5 Antibody - BSA Free

(2 Reviews)

(44 Publications)

Species: Ce, Ch, Dr, Hu, Mu, Rt, Sh, Ze

Applications: Flow, ICC/IF, IHC-FrFl, IHC, IHC-P, Simple Western, WB

ATPB Recombinant
Protein Antigen

NBP1-90816PEP

Species: Hu

Applications: AC

Publications for ATPB Protein (NBP1-90816PEP) (0)

There are no publications for ATPB Protein (NBP1-90816PEP).

By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ATPB Protein (NBP1-90816PEP) (0)

There are no reviews for ATPB Protein (NBP1-90816PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.

Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for ATPB Protein (NBP1-90816PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ATPB Products

Research Areas for ATPB Protein (NBP1-90816PEP)

Find related products by research area.

Blogs on ATPB

There are no specific blogs for ATPB, but you can read our latest blog posts.

Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

beta-Actin Antibody (AC-15)
NB600-501

Analysis of cell line lysates probed with mouse mAb to GAPDH (theoretical molecular weight: 36 kDa), NB300-221, dilution 1:2,000: [1] protein standard, [2] HEK293, [3] HeLa, [4] SH-SY5Y, [5] COS1, [6] NIH-3T3, and [7] C6 cells. The GAPDH antibody reveals a single band at ~37 kDa in all cell lines. GAPDH is a house keeping protein, the level of which is relatively unaffected by most experimental manipulations, and, as a result, this antibody has been widely used as a western blotting loading control.

GAPDH Antibody (1D4)
NB300-221

Contact Information

Product PDFs

SDS

PDF Datasheet

Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

Volume

Mass

Concentration

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

Mass

Concentration

Volume

Molecular Weight* g/mol

Review this Product

Be the first to review our ATPB Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol

ATP5F1B

Popular Products	Company Information	Support	Stay Connected
Antibodies Secondary Antibodies Isotype Controls Proteins and Peptides ELISA Kits Sample Size New Products	About Us Careers Novus Guarantee Contact Us Our Team	Technical Support FAQs Help Finding Antibodies Protocols

Visit our other sites

At	=	A. thaliana	SyHa	=	Golden Syrian Hamster
All	=	All Species	Ha	=	Hamster
An	=	Animal	Hu	=	Human
ArHa	=	Armenian Hamster	I	=	Insect
Av	=	Avian	Ll	=	Llama
Bb	=	Baboon	Ma	=	Mammal
Ba	=	Bacteria	Mk	=	Monkey
Bv	=	Bovine	Mu	=	Mouse
Ca	=	Canine	Multi	=	Multi-species
Ce	=	C. Elegans	NA	=	Non-species specific
Ch	=	Chicken	Or	=	Orangutan
ChHa	=	Chinese Hamster	Pl	=	Plant
Cm	=	Cynomolgus Monkey	Pm	=	Primate
Do	=	Donkey	Po	=	Porcine
Dr	=	Drosophilia	Rb	=	Rabbit
Ec	=	E. Coli	Rt	=	Rat
Eq	=	Equine	RM	=	Rhesus Macaque
Fe	=	Feline	Sh	=	Sheep
Ft	=	Ferret	Vb	=	Vertebrate
Fi	=	Fish	Vi	=	Virus
Fu	=	Fungi	Xp	=	Xenopus
Ge	=	Gerbil	Ye	=	Yeast
GP	=	Guinea Pig	Ze	=	Zebrafish
Gt	=	Goat

ATPB Recombinant Protein Antigen

Species Glossary

Images

Product Details

Order Details

ATPB Recombinant Protein Antigen Summary

Applications/Dilutions

Packaging, Storage & Formulations

Alternate Names for ATPB Recombinant Protein Antigen

Background

Limitations

Customers Who Viewed This Item Also Viewed...

Publications for ATPB Protein (NBP1-90816PEP) (0)

Reviews for ATPB Protein (NBP1-90816PEP) (0)

FAQs for ATPB Protein (NBP1-90816PEP) (0)

Additional ATPB Products

Research Areas for ATPB Protein (NBP1-90816PEP)

Blogs on ATPB

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Molarity Calculator

Review this Product

Bioinformatics