Reactivity | Hu, Mu, RtSpecies Glossary |
Applications | WB, ICC/IF, IHC |
Clone | S76-8 |
Clonality | Monoclonal |
Host | Mouse |
Conjugate | DyLight 680 |
Immunogen | Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical). |
Localization | Cytoplasm , Nucleus |
Specificity | Detects approx 85kDa. |
Isotype | IgG2b |
Clonality | Monoclonal |
Host | Mouse |
Gene | ATXN1 |
Purity | Protein G purified |
Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
Dilutions |
|
Application Notes | Optimal dilution of this antibody should be experimentally determined. |
Storage | Store at 4C in the dark. |
Buffer | 50mM Sodium Borate |
Preservative | 0.05% Sodium Azide |
Purity | Protein G purified |
Secondary Antibodies |
Isotype Controls |
ATXN2 Identified as New Genetic Risk Factor for Lou Gehrig's Disease (ALS) Ataxin antibodies are used in the study of autosomal dominant cerebellar ataxia (ADCA) diseases. These neurodegenerative disorders are highly heterogeneous, characterized by progressive, irreversible, atrophy of the cerebellum and spinal cord.Ataxin... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
Gene Symbol | ATXN1 |