![Immunohistochemistry-Paraffin: ASRGL1 Antibody [NBP2-38759] - Analysis in human fallopian tube and skeletal muscle tissues. Corresponding ASRGL1 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/ASRGL1-Antibody-Immunohistochemistry-Paraffin-NBP2-38759-img0009.jpg "Immunohistochemistry-Paraffin: ASRGL1 Antibody [NBP2-38759] - Analysis in human fallopian tube and skeletal muscle tissues. Corresponding ASRGL1 RNA-seq data are presented for the same tissues.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, IHC, KD |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: ARLTLFHIEQGKTVEEAADLSLGYMKSRVKGLGGLIVVSKTGDWVAKWTSTSMPWAAAKDGKLHFGIDPDDT |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | ASRGL1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Immunohistochemistry PTH Antibody (918462) [Unconjugated]](https://images.novusbio.com/images2/PTH_MAB7665_Immunohistochemistry_16650.jpg)
![Western Blot PTH Antibody (918462) [Unconjugated]](https://images.novusbio.com/images2/PTH_MAB7665_Western_Blot_16656.jpg)
![Simple Western Albumin Antibody (188835) [Unconjugated] - Serum](https://images.novusbio.com/images2/Albumin_MAB1455_Simple_Western_21888.jpg)
![Immunocytochemistry Albumin Antibody (188835) [Unconjugated] - Serum](https://images.novusbio.com/images2/Albumin_MAB1455_Immunocytochemistry__Immunofluorescence_17777.jpg)
![Immunohistochemistry Albumin Antibody (188835) [Unconjugated] - Serum](https://images.novusbio.com/images2/Albumin_MAB1455_Immunohistochemistry_23317.jpg)
![Immunocytochemistry Osteopontin/OPN Antibody [Unconjugated]](https://images.novusbio.com/images2/Osteopontin_AF808_Immunocytochemistry__Immunofluorescence_23325.jpg)
![Neutralization Osteopontin/OPN Antibody [Unconjugated]](https://images.novusbio.com/images2/Osteopontin_AF808_Block_Neutralize_8975.jpg)
![Immunohistochemistry Osteopontin/OPN Antibody [Unconjugated]](https://images.novusbio.com/images2/Osteopontin_AF808_Immunohistochemistry_9333.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for ASRGL1 Antibody (NBP2-38759)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunohistochemistry-Paraffin: ASRGL1 Antibody [NBP2-38759] - Staining of human cervix, uterine, endometrium, fallopian tube and skeletal muscle using Anti-ASRGL1 antibody NBP2-38759 (A) shows similar protein distribution across tissues to independent antibody NBP1-89133 (B).](http://images.novusbio.com/fullsize/ASRGL1-Antibody-Immunohistochemistry-Paraffin-NBP2-38759-img0008.jpg "Immunohistochemistry-Paraffin: ASRGL1 Antibody [NBP2-38759] - Staining of human cervix, uterine, endometrium, fallopian tube and skeletal muscle using Anti-ASRGL1 antibody NBP2-38759 (A) shows similar protein distribution across tissues to independent antibody NBP1-89133 (B).")
![Western Blot: ASRGL1 Antibody [NBP2-38759] - Analysis in EFO-21 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-ASRGL1 antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.](http://images.novusbio.com/fullsize/ASRGL1-Antibody-Western-Blot-NBP2-38759-img0007.jpg "Western Blot: ASRGL1 Antibody [NBP2-38759] - Analysis in EFO-21 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-ASRGL1 antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.")
![Immunohistochemistry-Paraffin: ASRGL1 Antibody [NBP2-38759] - Staining of human endometrium shows moderate to strong cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/ASRGL1-Antibody-Immunohistochemistry-Paraffin-NBP2-38759-img0012.jpg "Immunohistochemistry-Paraffin: ASRGL1 Antibody [NBP2-38759] - Staining of human endometrium shows moderate to strong cytoplasmic positivity in glandular cells.")
![Western Blot: ASRGL1 Antibody [NBP2-38759] - Analysis in control (vector only transfected HEK293T lysate) and ASRGL1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).](http://images.novusbio.com/fullsize/ASRGL1-Antibody-Western-Blot-NBP2-38759-img0006.jpg "Western Blot: ASRGL1 Antibody [NBP2-38759] - Analysis in control (vector only transfected HEK293T lysate) and ASRGL1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).")
![Immunohistochemistry-Paraffin: ASRGL1 Antibody [NBP2-38759] - Staining of human fallopian tube shows moderate to strong cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/ASRGL1-Antibody-Immunohistochemistry-Paraffin-NBP2-38759-img0010.jpg "Immunohistochemistry-Paraffin: ASRGL1 Antibody [NBP2-38759] - Staining of human fallopian tube shows moderate to strong cytoplasmic positivity in glandular cells.")
![Immunohistochemistry-Paraffin: ASRGL1 Antibody [NBP2-38759] - Staining of human skeletal muscle shows no positivity in myocytes as expected.](http://images.novusbio.com/fullsize/ASRGL1-Antibody-Immunohistochemistry-Paraffin-NBP2-38759-img0011.jpg "Immunohistochemistry-Paraffin: ASRGL1 Antibody [NBP2-38759] - Staining of human skeletal muscle shows no positivity in myocytes as expected.")
![Immunohistochemistry-Paraffin: ASRGL1 Antibody [NBP2-38759] - Staining of human cervix, uterine shows moderate to strong cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/ASRGL1-Antibody-Immunohistochemistry-Paraffin-NBP2-38759-img0013.jpg "Immunohistochemistry-Paraffin: ASRGL1 Antibody [NBP2-38759] - Staining of human cervix, uterine shows moderate to strong cytoplasmic positivity in glandular cells.")
![Bioactivity BMP-2 [Unconjugated]](https://images.novusbio.com/images/protein/355-bm_recombinant-human-mouse-rat-bmp-2-protein-bioactivity-181120209742.jpg)
![Immunocytochemistry RUNX2/CBFA1 Antibody (232902) [Unconjugated]](https://images.novusbio.com/images2/RUNX2_MAB2006_Immunocytochemistry_13309.jpg)
![Western Blot Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Western_Blot_5287.jpg)
![Simple Western Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Simple_Western_16990.jpg)
![Knockout Validated Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Knockout_Validated_24032.jpg)
![Bioactivity IBSP/Sialoprotein II [Unconjugated]](https://images.novusbio.com/images/4014-sp_recombinant-human-ibsp-sialoprotein-ii-protein-cf-bioactivity-4420249391..jpg)
![N/A Osteoprotegerin/TNFRSF11B [Biotin]](https://images.novusbio.com/images2/DATA_Osteoprotegerin_DY805_ELISA_2238.jpg)
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")