ARPP-21 Antibody - BSA Free Summary
| Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: EQGDLNQAIAEEGGTEQETATPENGIVKSESLDEEEKLELQRRLEAQNQERRKSKSGAGKGKLTRSLAVCEESSARPGGESLQDQESIHLQLSSFSSLQEEDKSRKDDSEREKEKDKNKDKTSEKPKIRMLSKDCSQEYT |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
ARPP21 |
| Purity |
Immunogen affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry 1:1000 - 1:2500
- Immunohistochemistry-Paraffin 1:1000 - 1:2500
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Control Peptide |
|
Reactivity Notes
Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (87%), Rat (88%)
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Immunogen affinity purified |
Alternate Names for ARPP-21 Antibody - BSA Free
Background
Isoform 2 may act as a competitive inhibitor of calmodulin-dependent enzymes such as calcineurin in neurons
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
Species: Hu
Applications: BA
Species: Bv, Ch, Eq, Gp, Hu, Mu, Po, Rb, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Bv, Ca, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, WB
Species: Hu
Applications: ELISA
Species: Mu
Applications: CyTOF-ready, Dual ISH-IHC, Flow, IHC
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Rt
Applications: ELISA, ICC/IF, S-ELISA, WB
Species: Hu
Applications: BA
Species: Hu
Applications: IHC, Neut, Simple Western, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Bv, Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ELISA, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
Species: Hu
Applications: IHC
Publications for ARPP-21 Antibody (NBP1-90096) (0)
There are no publications for ARPP-21 Antibody (NBP1-90096).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for ARPP-21 Antibody (NBP1-90096) (0)
There are no reviews for ARPP-21 Antibody (NBP1-90096).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for ARPP-21 Antibody (NBP1-90096) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional ARPP-21 Products
Blogs on ARPP-21
![Immunohistochemistry-Paraffin: ARPP-21 Antibody [NBP1-90096] - Staining of human skeletal muscle shows very weak cytoplasmic positivity in myocytes.](http://images.novusbio.com/fullsize/ARPP-21-Antibody-Immunohistochemistry-Paraffin-NBP1-90096-img0016.jpg "Immunohistochemistry-Paraffin: ARPP-21 Antibody [NBP1-90096] - Staining of human skeletal muscle shows very weak cytoplasmic positivity in myocytes.")
![Immunohistochemistry-Paraffin: ARPP-21 Antibody [NBP1-90096] - Analysis in human cerebral cortex and prostate tissues. Corresponding ARPP21 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/ARPP-21-Antibody-Immunohistochemistry-Paraffin-NBP1-90096-img0012.jpg "Immunohistochemistry-Paraffin: ARPP-21 Antibody [NBP1-90096] - Analysis in human cerebral cortex and prostate tissues. Corresponding ARPP21 RNA-seq data are presented for the same tissues.")
![Immunohistochemistry-Paraffin: ARPP-21 Antibody [NBP1-90096] - Staining of human cerebral cortex shows weak cytoplasmic positivity in neurons.](http://images.novusbio.com/fullsize/ARPP-21-Antibody-Immunohistochemistry-Paraffin-NBP1-90096-img0013.jpg "Immunohistochemistry-Paraffin: ARPP-21 Antibody [NBP1-90096] - Staining of human cerebral cortex shows weak cytoplasmic positivity in neurons.")
![Immunohistochemistry-Paraffin: ARPP-21 Antibody [NBP1-90096] - Staining of human kidney shows no positivity in cells in tubules as expected.](http://images.novusbio.com/fullsize/ARPP-21-Antibody-Immunohistochemistry-Paraffin-NBP1-90096-img0014.jpg "Immunohistochemistry-Paraffin: ARPP-21 Antibody [NBP1-90096] - Staining of human kidney shows no positivity in cells in tubules as expected.")
![Immunohistochemistry-Paraffin: ARPP-21 Antibody [NBP1-90096] - Staining of human prostate shows no positivity in glandular cells as expected.](http://images.novusbio.com/fullsize/ARPP-21-Antibody-Immunohistochemistry-Paraffin-NBP1-90096-img0015.jpg "Immunohistochemistry-Paraffin: ARPP-21 Antibody [NBP1-90096] - Staining of human prostate shows no positivity in glandular cells as expected.")
![FGF basic/FGF2/bFGF [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "FGF basic/FGF2/bFGF [Unconjugated]")
![N/A BDNF [HRP]](https://images.novusbio.com/images2/DATA_BDNF_DBD00_ELISA_587.jpg)
![N/A BDNF [HRP]](https://images.novusbio.com/images2/DATA_BDNF_DBD00_ELISA_588.jpg)
![N/A BDNF [HRP]](https://images.novusbio.com/images2/BDNF_DBD00_ELISA_36.jpg)
![Flow Cytometry Mer Antibody [Unconjugated]](https://images.novusbio.com/images2/Mer_AF591_Flow_Cytometry_12100.jpg)
![Immunohistochemistry Mer Antibody [Unconjugated]](https://images.novusbio.com/images2/Mer_AF591_Immunohistochemistry_22755.jpg)
![Dual RNAscope ISH-IHC Compatible Mer Antibody [Unconjugated]](https://images.novusbio.com/images2/Mer_AF591_Dual_RNAscope_ISHIHC_23834.jpg)
![SDS-PAGE LIGHT/TNFSF14 [Unconjugated]](https://images.novusbio.com/images2/LIGHT_664-LI_719.jpg)
![Bioactivity LIGHT/TNFSF14 [Unconjugated]](https://images.novusbio.com/images2/LIGHT_664-LI_721.jpg)
![SDS-PAGE CNTF [Unconjugated]](https://images.novusbio.com/images2/CNTF_257-NT_502.jpg)
![Bioactivity CNTF [Unconjugated]](https://images.novusbio.com/images2/CNTF_257-NT_520.jpg)
![Immunohistochemistry FGF acidic/FGF1 Antibody [Unconjugated]](https://images.novusbio.com/images2/FGF_acidic_AF232_Immunohistochemistry_17183.jpg)
![Simple Western FGF acidic/FGF1 Antibody [Unconjugated]](https://images.novusbio.com/images2/FGF_acidic_AF232_Simple_Western_17471.jpg)
![Western Blot FGF acidic/FGF1 Antibody [Unconjugated]](https://images.novusbio.com/images2/FGF_acidic_AF232_Western_Blot_18640.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")