![Western Blot: RPE Antibody [NBP3-35469] - Western blot analysis of various lysates using RPE Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 5s.](http://images.novusbio.com/fullsize/nbp3-35469_rabbit-rpe-pab-9122024159568.jpg "Western Blot: RPE Antibody [NBP3-35469] - Western blot analysis of various lysates using RPE Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 5s.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ELISA, ICC/IF |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-228 of human RPE (NP_954699.1). Sequence: MASGCKIGPSILNSDLANLGAECLRMLDSGADYLHLDVMDGHFVPNITFGHPVVESLRKQLGQDPFFDMHMMVSKPEQWVKPMAVAGANQYTFHLEATENPGALIKDIRENGMKVGLAIKPGTSVEYLAPWANQIDMALVMTVEPGFGGQKFMEDMMPKVHWLRTQFPSLDIEVDGGVGPDTVHKCAEAGANMIVSGSAIMRSEDPRSVINLLRNVCSEAAQKRSLDR |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | RPE |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Theoretical MW | 25 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.3), 50% glycerol |
| Preservative | 0.01% Thimerosal |
| Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
|
Using RPE65 as a tool to investigate ocular gene therapies While not life threatening, blindness and retinal disease are profoundly debilitating and greatly affect quality of life. Understandably, gene therapy has been subject to controversy given it’s potential effects on the rest of our cellular ... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | RPE |
![Immunocytochemistry/ Immunofluorescence: RPE Antibody [NBP3-35469] - Immunofluorescence analysis of L929 cells using RPE Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/nbp3-35469_rabbit-rpe-pab-91220241411287.jpg "Immunocytochemistry/ Immunofluorescence: RPE Antibody [NBP3-35469] - Immunofluorescence analysis of L929 cells using RPE Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.")
![N/A VEGF [HRP]](https://images.novusbio.com/images2/DATA_VEGF_DVE00_ELISA_871.jpg)
![N/A VEGF [HRP]](https://images.novusbio.com/images2/DATA_VEGF_DVE00_ELISA_872.jpg)
![N/A VEGF [HRP]](https://images.novusbio.com/images2/VEGF_DVE00_ELISA_208.jpg)
![SDS-PAGE LIGHT/TNFSF14 [Unconjugated]](https://images.novusbio.com/images2/LIGHT_664-LI_719.jpg)
![Bioactivity LIGHT/TNFSF14 [Unconjugated]](https://images.novusbio.com/images2/LIGHT_664-LI_721.jpg)
![FGF basic/FGF2/bFGF [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "FGF basic/FGF2/bFGF [Unconjugated]")
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![N/A Serpin F1/PEDF [Biotin]](https://images.novusbio.com/images2/DATA_Serpin_F1_DY117705_ELISA_2344.jpg)
![Immunocytochemistry Plexin A2 Antibody [Unconjugated]](https://images.novusbio.com/images2/Plexin_A2_AF5486_Immunocytochemistry_11380.jpg)
![Immunocytochemistry Plexin A2 Antibody [Unconjugated]](https://images.novusbio.com/images2/Plexin_A2_AF5486_Immunocytochemistry_11381.jpg)
![Simple Western Plexin A2 Antibody [Unconjugated]](https://images.novusbio.com/images2/Plexin_A2_AF5486_Simple_Western_17021.jpg)
![N/A IL-6 [HRP]](https://images.novusbio.com/images2/DATA_IL6_M6000_ELISA_936.jpg)
![N/A IL-6 [HRP]](https://images.novusbio.com/images2/IL-6_M6000_ELISA_415.jpg)
![N/A IL-6 [HRP]](https://images.novusbio.com/images/m6000b_mouse-il-6-quantikine-elisa-kit-44202415433118.jpg)
![Western Blot ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Western_Blot_5097.jpg)
![Immunohistochemistry ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Immunohistochemistry_20696.jpg)
![Knockout Validated ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Knockout_Validated_22864.jpg)
![Flow Cytometry CD155/PVR Antibody (300907) [Unconjugated]](https://images.novusbio.com/images2/CD155_MAB25301_Flow_Cytometry_20610.jpg)
![Flow Cytometry CD155/PVR Antibody (300907) [Unconjugated]](https://images.novusbio.com/images2/CD155_MAB25301_Flow_Cytometry_20611.jpg)
![Immunocytochemistry CD155/PVR Antibody (300907) [Unconjugated]](https://images.novusbio.com/images2/CD155_MAB25301_Immunocytochemistry__Immunofluorescence_17423.jpg)
![N/A CCL2/JE/MCP-1 [HRP]](https://images.novusbio.com/images2/CCL2_DCP00_ELISA_67.jpg)
![N/A CCL2/JE/MCP-1 [HRP]](https://images.novusbio.com/images2/DATA_CCL2_DCP00_ELISA_633.jpg)
![N/A CCL2/JE/MCP-1 [HRP]](https://images.novusbio.com/images2/DATA_CCL2_DCP00_ELISA_634.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")