Home » ARHGEF7 » ARHGEF7 Antibodies » ARHGEF7 Antibody
Novus Biologicals products are now on bio-techne.com

ARHGEF7 Antibody

 Submit a Review

Images

 
(
Enlarge)
Western Blot: ARHGEF7 Antibody [NBP2-84456] - Host: Rabbit. Target Name: ARHGEF7. Sample Tissue: Human 293T Whole Cell lysates. Antibody Dilution: 1ug/ml
Western Blot: ARHGEF7 Antibody [NBP2-84456] - Host: Rabbit. Target Name: ARHGEF7. Sample Tissue: Human 293T Whole Cell lysates. Antibody Dilution: 1ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Concentration
0.5 mg/ml

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

ARHGEF7 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human ARHGEF7. Peptide sequence: RYLLLFPNVLLMLSASPRMSGFIYQGKLPTTGMTITKLEDSENHRNAFEI The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
ARHGEF7
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Concentration
0.5 mg/ml
Purity
Affinity purified

Alternate Names for ARHGEF7 Antibody

  • Beta-Pix
  • COOL1COOL-1
  • DKFZp686C12170
  • DKFZp761K1021
  • guanine nucleotide exchange factor 7
  • KIAA0142KIAA0412
  • Nbla10314
  • P50
  • P50BP
  • P85
  • P85COOL1
  • P85SPRBETA-PIX
  • PAK3
  • PAK3BP
  • PIXBPAK-interacting exchange factor beta
  • Rho guanine nucleotide exchange factor (GEF) 7
  • rho guanine nucleotide exchange factor 7
  • SH3 domain-containing proline-rich protein

Background

ARHGEF7, also known as Rho guanine nucleotide exchange factor 7, contains many isoforms that are 90 kDa, 87 kDa, 84 kDa, 82 kDa, 73 kDa, and 70 kDa, and is involved in apoptosis regulation, cell migration, and cell spreading. Current disease research is being conducted on ARHGEF7 and its relation to Borjeson-Forssmann-Lehmann Syndrome, t-cell leukemia, breast cancer, Wiskott-Aldrich Syndrome, insulin resistance, neuronitis, pancreatitis, leukemia, neuroblastoma, insulin resistance, adenocarcinoma, and lung cancer. This protein is linked to the GPCR pathway and the RhoA pathway, and it interacts with SCRIB, CBL, GIT1, PAK1, and CBLB.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Human, Mouse, Rat
RelA/NFkB p65 ELISA K ...
NBP2-29661
ELISA Human, Mouse, Rat RelA/NFkB p65 ELISA Kit (Colorimetric)
ELISA Human, Mouse, Rat RelA/NFkB p65 ELISA Kit (Colorimetric)
ELISA Human, Mouse, Rat RelA/NFkB p65 ELISA Kit (Colorimetric)
(95 Publications)
Species: Hu, Mu, Rt
Applications: ELISA
NFkB p105/p50
Antibody (2J10D7) - B ...
NB100-56583
Flow Cytometry NFkB p105/p50 Antibody (2J10D7) - BSA Free
Flow Cytometry NFkB p105/p50 Antibody (2J10D7) - BSA Free
Flow Cytometry NFkB p105/p50 Antibody (2J10D7) - BSA Free
(1 Review)
(5 Publications)
Species: Hu, Rb, Rt
Applications: Flow, IHC, IHC-P, KO, WB
Synaptotagmin 1
Antibody (ASV48) [Unc ...
MAB4364
Immunocytochemistry Synaptotagmin 1 Antibody (ASV48) [Unconjugated]
Immunohistochemistry Synaptotagmin 1 Antibody (ASV48) [Unconjugated]
Immunocytochemistry Synaptotagmin 1 Antibody (ASV48) [Unconjugated]
(1 Publication)
Species: Rt
Applications: ICC, IHC, IP, KO, WB
WNK1 Antibody
[Unconjugated]
AF2849
Western Blot WNK1 Antibody [Unconjugated]
(5 Publications)
Species: Mu, Rt
Applications: WB
GRASP65 Antibody
(OTI5G8)
NBP2-02665
Immunocytochemistry/ Immunofluorescence GRASP65 Antibody (OTI5G8)
Immunocytochemistry/ Immunofluorescence GRASP65 Antibody (OTI5G8)
Flow Cytometry GRASP65 Antibody (OTI5G8)
(3 Reviews)
(2 Publications)
Species: Ca, Hu, Pm, Po, Pm, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
TNF-alpha
[Unconjugated]
210-TA
SDS-PAGE TNF-alpha [Unconjugated]
Bioactivity TNF-alpha [Unconjugated]
SEC-MALS TNF-alpha [Unconjugated]
(3 Reviews)
(808 Publications)
Species: Hu
Applications: BA
AKT [p Ser473]
Antibody [Unconjugate ...
AF887
Western Blot AKT [p Ser473] Antibody [Unconjugated] - Pan Specific
Simple Western AKT [p Ser473] Antibody [Unconjugated] - Pan Specific
Intracellular Staining by Flow Cytometry AKT [p Ser473] Antibody [Unconjugated] - Pan Specific
(49 Publications)
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
c-Rel Antibody
[Unconjugated]
AF2699
Simple Western c-Rel Antibody [Unconjugated]
Western Blot c-Rel Antibody [Unconjugated]
(1 Review)
(2 Publications)
Species: Hu, Mu
Applications: Simple Western, WB
PI 3-Kinase p110
beta/PIK3CB Antibody ...
MAB2686
Western Blot PI 3-Kinase p110 beta/PIK3CB Antibody (269020)
(5 Publications)
Species: Hu
Applications: WB
IRS1 Antibody
NB100-82001
Immunohistochemistry-Paraffin IRS1 Antibody
Western Blot IRS1 Antibody
Immunocytochemistry/ Immunofluorescence IRS1 Antibody
(4 Publications)
Species: Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-P, WB
PI 3-Kinase p110
gamma Antibody
NBP2-15071
Western Blot PI 3-Kinase p110 gamma Antibody
Immunohistochemistry-Paraffin PI 3-Kinase p110 gamma Antibody
Western Blot PI 3-Kinase p110 gamma Antibody
(3 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KO, WB
PI 3-Kinase p110
delta Antibody (OTI1D ...
NBP2-46404
Immunohistochemistry PI 3-Kinase p110 delta Antibody (OTI1D11)
Immunohistochemistry PI 3-Kinase p110 delta Antibody (OTI1D11)
Immunohistochemistry PI 3-Kinase p110 delta Antibody (OTI1D11)
(1 Review)
Species: Hu, Mu, Rt
Applications: IHC, IHC-P
PIK3CA Antibody
NBP2-19804
Western Blot PIK3CA Antibody
Immunohistochemistry-Paraffin PIK3CA Antibody
Western Blot PIK3CA Antibody
(4 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
c-jun [p Ser63]
Antibody (1018Y) [Unc ...
MAB8930
Western Blot c-jun [p Ser63] Antibody (1018Y) [Unconjugated]
Immunocytochemistry c-jun [p Ser63] Antibody (1018Y) [Unconjugated]
Simple Western c-jun [p Ser63] Antibody (1018Y) [Unconjugated]
(1 Review)
(3 Publications)
Species: Hu
Applications: ICC, Simple Western, WB
NFkB2/NFkB p100
Antibody
NBP1-87760
Immunohistochemistry-Paraffin NFkB2/NFkB p100 Antibody
Immunohistochemistry-Paraffin NFkB2/NFkB p100 Antibody
Immunohistochemistry-Paraffin NFkB2/NFkB p100 Antibody
(1 Publication)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, Simple Western, WB
CDP/CUTL1 Antibody
(2A10)
H00001523-M01
Western Blot CDP/CUTL1 Antibody (2A10)
Immunohistochemistry-Paraffin CDP/CUTL1 Antibody (2A10)
ELISA CDP/CUTL1 Antibody (2A10)
(1 Review)
(4 Publications)
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
ERK2 Antibody
[Unconjugated]
AF1230
Western Blot ERK2 Antibody [Unconjugated]
Immunohistochemistry ERK2 Antibody [Unconjugated]
Knockout Validated ERK2 Antibody [Unconjugated]
(3 Publications)
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
c-Fos Antibody
(2H2)
NBP2-50037
Knockout Validated c-Fos Antibody (2H2)
Immunocytochemistry/ Immunofluorescence c-Fos Antibody (2H2)
Immunocytochemistry/ Immunofluorescence c-Fos Antibody (2H2)
(1 Review)
(19 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KO, WB
IL-6 [HRP]
M6000B
N/A IL-6 [HRP]
N/A IL-6 [HRP]
N/A IL-6 [HRP]
(640 Publications)
Species: Mu
Applications: ELISA
SART3 Antibody
NB100-74648
Immunohistochemistry-Paraffin SART3 Antibody
Immunohistochemistry-Paraffin SART3 Antibody
Western Blot SART3 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, WB

Publications for ARHGEF7 Antibody (NBP2-84456) (0)

There are no publications for ARHGEF7 Antibody (NBP2-84456).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ARHGEF7 Antibody (NBP2-84456) (0)

There are no reviews for ARHGEF7 Antibody (NBP2-84456). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ARHGEF7 Antibody (NBP2-84456) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ARHGEF7 Products

Research Areas for ARHGEF7 Antibody (NBP2-84456)

Find related products by research area.

Blogs on ARHGEF7

There are no specific blogs for ARHGEF7, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ARHGEF7 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol ARHGEF7