![Immunohistochemistry-Paraffin: Aquaporin-3 Antibody [NBP2-33872] - Staining in human esophagus and skeletal muscle tissues . Corresponding AQP3 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/Aquaporin-3-Antibody-Immunohistochemistry-Paraffin-NBP2-33872-img0023.jpg "Immunohistochemistry-Paraffin: Aquaporin-3 Antibody [NBP2-33872] - Staining in human esophagus and skeletal muscle tissues . Corresponding AQP3 RNA-seq data are presented for the same tissues.")
| Reactivity | Hu, MuSpecies Glossary |
| Applications | ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: QLMIGCHLEQPPPSNEEENVKLAHVKHKEQI |
| Predicted Species | Mouse (94%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | AQP3 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Immunohistochemistry Neurophysin II/Arg-vasopressin Antibody [Unconjugated]](https://images.novusbio.com/images/antibody/af009_human-neurophysin-ii-affinity-purified-polyclonal-ab-immunohistochemistry-2812202013195.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for Aquaporin-3 Antibody (NBP2-33872)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunocytochemistry/Immunofluorescence: Aquaporin-3 Antibody [NBP2-33872] - Staining of human cell line RT4 shows localization to plasma membrane. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/Aquaporin-3-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-33872-img0009.jpg "Immunocytochemistry/Immunofluorescence: Aquaporin-3 Antibody [NBP2-33872] - Staining of human cell line RT4 shows localization to plasma membrane. Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: Aquaporin-3 Antibody [NBP2-33872] - Staining of human esophagus shows membranous positivity in squamous epithelial cells.](http://images.novusbio.com/fullsize/Aquaporin-3-Antibody-Immunohistochemistry-Paraffin-NBP2-33872-img0018.jpg "Immunohistochemistry-Paraffin: Aquaporin-3 Antibody [NBP2-33872] - Staining of human esophagus shows membranous positivity in squamous epithelial cells.")
![Immunohistochemistry-Paraffin: Aquaporin-3 Antibody [NBP2-33872] - Staining of human kidney shows membranous positivity in cells in distal tubules.](http://images.novusbio.com/fullsize/Aquaporin-3-Antibody-Immunohistochemistry-Paraffin-NBP2-33872-img0019.jpg "Immunohistochemistry-Paraffin: Aquaporin-3 Antibody [NBP2-33872] - Staining of human kidney shows membranous positivity in cells in distal tubules.")
![Immunohistochemistry-Paraffin: Aquaporin-3 Antibody [NBP2-33872] - Staining of human prostate shows membranous positivity in glandular cells.](http://images.novusbio.com/fullsize/Aquaporin-3-Antibody-Immunohistochemistry-Paraffin-NBP2-33872-img0020.jpg "Immunohistochemistry-Paraffin: Aquaporin-3 Antibody [NBP2-33872] - Staining of human prostate shows membranous positivity in glandular cells.")
![Immunohistochemistry-Paraffin: Aquaporin-3 Antibody [NBP2-33872] - Staining of human skeletal muscle shows no positivity in myocytes as expected.](http://images.novusbio.com/fullsize/Aquaporin-3-Antibody-Immunohistochemistry-Paraffin-NBP2-33872-img0021.jpg "Immunohistochemistry-Paraffin: Aquaporin-3 Antibody [NBP2-33872] - Staining of human skeletal muscle shows no positivity in myocytes as expected.")
![Immunohistochemistry-Paraffin: Aquaporin-3 Antibody [NBP2-33872] - Staining of human skin shows membranous positivity in epidermal cells.](http://images.novusbio.com/fullsize/Aquaporin-3-Antibody-Immunohistochemistry-Paraffin-NBP2-33872-img0022.jpg "Immunohistochemistry-Paraffin: Aquaporin-3 Antibody [NBP2-33872] - Staining of human skin shows membranous positivity in epidermal cells.")
![Western Blot ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Western_Blot_5097.jpg)
![Immunohistochemistry ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Immunohistochemistry_20696.jpg)
![Knockout Validated ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Knockout_Validated_22864.jpg)
![Western Blot IFN-alpha/beta R1 Antibody [Unconjugated]](https://images.novusbio.com/images2/af245_mouse-tsp50-affinity-purified-polyclonal-ab-western-blot-672022104711.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")