Reactivity | Hu, Mu, RtSpecies Glossary |
Applications | WB, IP |
Clone | 8X7Q1 |
Clonality | Monoclonal |
Host | Rabbit |
Conjugate | Unconjugated |
Additional Information | Recombinant Monoclonal Antibody |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human APC (NP_000029.2). MAAASYDQLLKQVEALKMENSNLRQELEDNSNHLTKLETEASNMKEVLKQLQGSIEDEAMASSGQIDLLERLKELNLDSSNFPGVKLRSKMSLRSYGSRE |
Isotype | IgG |
Clonality | Monoclonal |
Host | Rabbit |
Gene | APC |
Purity | Affinity purified |
Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
Storage | Store at -20C. Avoid freeze-thaw cycles. |
Buffer | PBS, 0.05% BSA, 50% glycerol, pH7.3 |
Preservative | 0.02% Sodium Azide |
Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for APC Antibody (NBP3-15561)Find related products by research area.
|
The role of MHC Class II RT1B and immune response post brain injury The major histocompatibility complex (MHC) is responsible for binding peptide fragments arising from pathogens in order to display them on the cell surface for recognition from immune cells. Once recognized, the foreign pathogen is typically evade... Read full blog post. |
Beta-catenin - I am versatile! Beta-catenin is a cytosolic, 88 kDa intracellular protein associated with cell surface cadherin glycoproteins. It is a member of the larger calcium-dependent catenin family that includes alpha-catenin, beta-catenin, and gamma-catenin (also known as pl... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
Gene Symbol | APC |