![Western Blot: ALAD Antibody [NBP1-89158] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10. Lane 2: Liver](http://images.novusbio.com/fullsize/ALAD-Antibody-Western-Blot-NBP1-89158-img0004.jpg "Western Blot: ALAD Antibody [NBP1-89158] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10. Lane 2: Liver")
| Reactivity | Hu, Rt, MuSpecies Glossary |
| Applications | WB, Simple Western, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: GCQVVAPSDMMDGRVEAIKEALMAHGLGNRVSVMSYSAKFASCFYGPFRDAAKSSPAFGDRRCYQLPPGARGLALRAVDRD |
| Predicted Species | Mouse (94%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | ALAD |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. In Simple Western only 10 - 15 uL of the recommended dilution is used per data point. Separated by Size. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
| Publication using NBP1-89158 | Applications | Species |
|---|---|---|
| Moreno-Navarrete JM, Rodriguez A, Ortega F et al. Heme Biosynthetic Pathway is Functionally Linked to Adipogenesis via Mitochondrial Respiratory Activity Obesity (Silver Spring) 2017-10-01 [PMID: 28857503] (WB, Rat) | WB | Rat |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | ALAD |
![Immunohistochemistry-Paraffin: ALAD Antibody [NBP1-89158] - Staining in human adrenal gland and pancreas tissues using anti-ALAD antibody. Corresponding ALAD RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/ALAD-Antibody-Immunohistochemistry-Paraffin-NBP1-89158-img0010.jpg "Immunohistochemistry-Paraffin: ALAD Antibody [NBP1-89158] - Staining in human adrenal gland and pancreas tissues using anti-ALAD antibody. Corresponding ALAD RNA-seq data are presented for the same tissues.")
![Immunohistochemistry-Paraffin: ALAD Antibody [NBP1-89158] - Staining of human adrenal gland shows high expression.](http://images.novusbio.com/fullsize/ALAD-Antibody-Immunohistochemistry-Paraffin-NBP1-89158-img0008.jpg "Immunohistochemistry-Paraffin: ALAD Antibody [NBP1-89158] - Staining of human adrenal gland shows high expression.")
![Immunohistochemistry-Paraffin: ALAD Antibody [NBP1-89158] - Staining of human pancreas shows low expression as expected.](http://images.novusbio.com/fullsize/ALAD-Antibody-Immunohistochemistry-Paraffin-NBP1-89158-img0009.jpg "Immunohistochemistry-Paraffin: ALAD Antibody [NBP1-89158] - Staining of human pancreas shows low expression as expected.")
![Simple Western: ALAD Antibody [NBP1-89158] - Simple Western lane view shows a specific band for ALAD in 0.2 mg/ml of h. Liver (left) and h. Adrenal (right) lysate(s). This experiment was performed under reducing conditions using the 12-230 kDa separation system.](http://images.novusbio.com/fullsize/ALAD-Antibody-Simple-Western-NBP1-89158-img0005.jpg "Simple Western: ALAD Antibody [NBP1-89158] - Simple Western lane view shows a specific band for ALAD in 0.2 mg/ml of h. Liver (left) and h. Adrenal (right) lysate(s). This experiment was performed under reducing conditions using the 12-230 kDa separation system.")
![Simple Western: ALAD Antibody [NBP1-89158] - Electropherogram image of the corresponding Simple Western lane view. ALAD antibody was used at 1:200 dilution on h. Liver and h. Adrenal lysate(s) respectively.](http://images.novusbio.com/fullsize/ALAD-Antibody-Simple-Western-NBP1-89158-img0006.jpg "Simple Western: ALAD Antibody [NBP1-89158] - Electropherogram image of the corresponding Simple Western lane view. ALAD antibody was used at 1:200 dilution on h. Liver and h. Adrenal lysate(s) respectively.")
![Western Blot Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Western_Blot_5287.jpg)
![Simple Western Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Simple_Western_16990.jpg)
![Knockout Validated Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Knockout_Validated_24032.jpg)
![N/A Erythropoietin/EPO [HRP]](https://images.novusbio.com/images2/DATA_Erythropoietin_MEP00_ELISA_970.jpg)
![N/A Erythropoietin/EPO [HRP]](https://images.novusbio.com/images2/Erythropoietin_MEP00_ELISA_421.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")