Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: LPLPRNITEGEARGSVILTVKPIFEVSPSPLEPEEPFTFAPEIGATAFAEVENETGEATRPWGFPTPG |
Isotype | IgG |
Clonality | Polyclonal |
Host | Rabbit |
Gene | ACAN |
Purity | Affinity purified |
Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
Dilutions |
|
||
Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
Control Peptide |
|
Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer | PBS (pH 7.2) and 40% Glycerol |
Preservative | 0.02% Sodium Azide |
Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for Aggrecan Antibody (NBP2-55539)Find related products by research area.
|
Aches & Pains: Aggrecan in Joint Disease and Osteoarthritis Aggrecan is essential for the normal function of articular cartilage and intervertebral discs. Aggrecan provides the ability for the tissues to withstand compressive loading. This property is dependent on both the high charge density endowed by its nu... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
Gene Symbol | ACAN |