![Western Blot: ADCK2 Antibody [NBP2-84396] - Host: Rabbit. Target Name: ADCK2. Sample Type: Jurkat Whole Cell lysates. Antibody Dilution: 1.0ug/mlADCK2 is supported by BioGPS gene expression data to be expressed in Jurkat](http://images.novusbio.com/fullsize/ADCK2-Antibody-Western-Blot-NBP2-84396-img0002.jpg "Western Blot: ADCK2 Antibody [NBP2-84396] - Host: Rabbit. Target Name: ADCK2. Sample Type: Jurkat Whole Cell lysates. Antibody Dilution: 1.0ug/mlADCK2 is supported by BioGPS gene expression data to be expressed in Jurkat")
| Reactivity | HuSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Concentration | 0.5 mg/ml |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of Human ADCK2. Peptide sequence: LGNGRKPPENLADQSFLERLLLPKADLVGSNAGVSRAQVPGHQPEATNLI The peptide sequence for this immunogen was taken from within the described region. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | ADCK2 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS, 2% Sucrose |
| Preservative | 0.09% Sodium Azide |
| Concentration | 0.5 mg/ml |
| Purity | Affinity purified |
![Immunohistochemistry Neurophysin II/Arg-vasopressin Antibody [Unconjugated]](https://images.novusbio.com/images/antibody/af009_human-neurophysin-ii-affinity-purified-polyclonal-ab-immunohistochemistry-2812202013195.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for ADCK2 Antibody (NBP2-84396)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | ADCK2 |
![Immunohistochemistry-Paraffin: ADCK2 Antibody [NBP2-84396] - Rabbit Anti-ADCK2 Antibody. Formalin Fixed Paraffin Embedded Tissue: Human Adult Liver. Observed Staining: Membrane in bile canaliculi, strong signal, wide tissue distribution. Primary Antibody Concentration: 1:100. Secondary Antibody: donkey anti-rabbit](http://images.novusbio.com/fullsize/ADCK2-Antibody-Immunohistochemistry-Paraffin-NBP2-84396-img0001.jpg "Immunohistochemistry-Paraffin: ADCK2 Antibody [NBP2-84396] - Rabbit Anti-ADCK2 Antibody. Formalin Fixed Paraffin Embedded Tissue: Human Adult Liver. Observed Staining: Membrane in bile canaliculi, strong signal, wide tissue distribution. Primary Antibody Concentration: 1:100. Secondary Antibody: donkey anti-rabbit")
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")