![Immunohistochemistry-Paraffin: ACADL Antibody [NBP1-89289] - Analysis in human thyroid gland and cerebral cortex tissues. Corresponding ACADL RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/ACADL-Antibody-Immunohistochemistry-Paraffin-NBP1-89289-img0009.jpg "Immunohistochemistry-Paraffin: ACADL Antibody [NBP1-89289] - Analysis in human thyroid gland and cerebral cortex tissues. Corresponding ACADL RNA-seq data are presented for the same tissues.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: GEERLETPSAKKLTDIGIRRIFSPEHDIFRKSVRKFFQEEVIPHHSEWEKAGEVSREVWEKAGKQGLLGVNIAEHLGGIGGDLYSAAIVWEEQAYSNCSGPGFSIHSGIVMSYITNHGSEEQIKHFIPQMT |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | ACADL |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for ACADL Antibody (NBP1-89289)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | ACADL |
![Western Blot: ACADL Antibody [NBP1-89289] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).](http://images.novusbio.com/fullsize/ACADL-Antibody-Western-Blot-NBP1-89289-img0004.jpg "Western Blot: ACADL Antibody [NBP1-89289] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).")
![Immunohistochemistry-Paraffin: ACADL Antibody [NBP1-89289] - Staining of human liver shows moderate cytoplasmic positivity in hepatocytes.](http://images.novusbio.com/fullsize/ACADL-Antibody-Immunohistochemistry-Paraffin-NBP1-89289-img0013.jpg "Immunohistochemistry-Paraffin: ACADL Antibody [NBP1-89289] - Staining of human liver shows moderate cytoplasmic positivity in hepatocytes.")
![Immunohistochemistry-Paraffin: ACADL Antibody [NBP1-89289] - Staining of human thyroid gland shows strong cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/ACADL-Antibody-Immunohistochemistry-Paraffin-NBP1-89289-img0010.jpg "Immunohistochemistry-Paraffin: ACADL Antibody [NBP1-89289] - Staining of human thyroid gland shows strong cytoplasmic positivity in glandular cells.")
![Immunohistochemistry-Paraffin: ACADL Antibody [NBP1-89289] - Staining of human lung shows moderate to strong granular cytoplasmic positivity in macrophages.](http://images.novusbio.com/fullsize/ACADL-Antibody-Immunohistochemistry-Paraffin-NBP1-89289-img0011.jpg "Immunohistochemistry-Paraffin: ACADL Antibody [NBP1-89289] - Staining of human lung shows moderate to strong granular cytoplasmic positivity in macrophages.")
![Immunohistochemistry-Paraffin: ACADL Antibody [NBP1-89289] - Staining of human kidney shows moderate granular cytoplasmic positivity in cells in tubules.](http://images.novusbio.com/fullsize/ACADL-Antibody-Immunohistochemistry-Paraffin-NBP1-89289-img0012.jpg "Immunohistochemistry-Paraffin: ACADL Antibody [NBP1-89289] - Staining of human kidney shows moderate granular cytoplasmic positivity in cells in tubules.")
![Immunohistochemistry-Paraffin: ACADL Antibody [NBP1-89289] - Staining of human cerebral cortex shows no positivity as expected.](http://images.novusbio.com/fullsize/ACADL-Antibody-Immunohistochemistry-Paraffin-NBP1-89289-img0014.jpg "Immunohistochemistry-Paraffin: ACADL Antibody [NBP1-89289] - Staining of human cerebral cortex shows no positivity as expected.")
![Immunocytochemistry M-Cadherin/Cadherin-15 Antibody [Unconjugated]](https://images.novusbio.com/images2/M-Cadherin_AF4096_Immunocytochemistry_10159.jpg)
![Flow Cytometry M-Cadherin/Cadherin-15 Antibody [Unconjugated]](https://images.novusbio.com/images2/M-Cadherin_AF4096_Flow_Cytometry_8228.jpg)
![Western Blot M-Cadherin/Cadherin-15 Antibody [Unconjugated]](https://images.novusbio.com/images2/M-Cadherin_AF4096_Western_Blot_9440.jpg)
![Immunohistochemistry Lipoprotein Lipase/LPL Antibody [Unconjugated]](https://images.novusbio.com/images2/Lipoprotein_Lipase_AF7197_Immunohistochemistry_21186.jpg)
![Western Blot Lipoprotein Lipase/LPL Antibody [Unconjugated]](https://images.novusbio.com/images2/Lipoprotein_Lipase_AF7197_Western_Blot_11656.jpg)
![Immunocytochemistry Lipoprotein Lipase/LPL Antibody [Unconjugated]](https://images.novusbio.com/images2/Lipoprotein_Lipase_AF7197_Immunocytochemistry_11911.jpg)
![Immunocytochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/Insulin_MAB1417_Immunocytochemistry_9376.jpg)
![Immunohistochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/mab1417_human-bovine-mouse-insulin-mab-clone-182410-immunohistochemistry-308202115145.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")