![Immunohistochemistry-Paraffin: ACADS Antibody [NBP1-89290] - Analysis in human duodenum and tonsil tissues. Corresponding ACADS RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/ACADS-Antibody-Immunohistochemistry-Paraffin-NBP1-89290-img0017.jpg "Immunohistochemistry-Paraffin: ACADS Antibody [NBP1-89290] - Analysis in human duodenum and tonsil tissues. Corresponding ACADS RNA-seq data are presented for the same tissues.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: ELPETHQMLLQTCRDFAEKELFPIAAQVDKEHLFPAAQVKKMGGLGLLAMDVPEELGGAGLDYLAYAIAMEEISRGCASTGVIMSVNNSLYLGPILKFGSKEQKQAWVTPFTSGDKIGCFALSEPGNGS |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | ACADS |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation/Permeabilization: PFA/Triton X-100. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for ACADS Antibody (NBP1-89290)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | ACADS |
![Western Blot: ACADS Antibody [NBP1-89290] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)](http://images.novusbio.com/fullsize/ACADS-Antibody-Western-Blot-NBP1-89290-img0004.jpg "Western Blot: ACADS Antibody [NBP1-89290] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)")
![Immunocytochemistry/Immunofluorescence: ACADS Antibody [NBP1-89290] - Staining of human cell line Hep G2 shows localization to mitochondria. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/ACADS-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-89290-img0010.jpg "Immunocytochemistry/Immunofluorescence: ACADS Antibody [NBP1-89290] - Staining of human cell line Hep G2 shows localization to mitochondria. Antibody staining is shown in green.")
![Western Blot: ACADS Antibody [NBP1-89290] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue. Lane 6: Human tonsil tissue](http://images.novusbio.com/fullsize/ACADS-Antibody-Western-Blot-NBP1-89290-img0003.jpg "Western Blot: ACADS Antibody [NBP1-89290] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue. Lane 6: Human tonsil tissue")
![Immunohistochemistry-Paraffin: ACADS Antibody [NBP1-89290] - Staining of human tonsil shows granular cytoplasmic positivity in germinal center cells.](http://images.novusbio.com/fullsize/ACADS-Antibody-Immunohistochemistry-Paraffin-NBP1-89290-img0011.jpg "Immunohistochemistry-Paraffin: ACADS Antibody [NBP1-89290] - Staining of human tonsil shows granular cytoplasmic positivity in germinal center cells.")
![Immunohistochemistry-Paraffin: ACADS Antibody [NBP1-89290] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.](http://images.novusbio.com/fullsize/ACADS-Antibody-Immunohistochemistry-Paraffin-NBP1-89290-img0013.jpg "Immunohistochemistry-Paraffin: ACADS Antibody [NBP1-89290] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.")
![Immunohistochemistry-Paraffin: ACADS Antibody [NBP1-89290] - Staining of human testis shows moderate cytoplasmic positivity in Leydig cells](http://images.novusbio.com/fullsize/ACADS-Antibody-Immunohistochemistry-Paraffin-NBP1-89290-img0014.jpg "Immunohistochemistry-Paraffin: ACADS Antibody [NBP1-89290] - Staining of human testis shows moderate cytoplasmic positivity in Leydig cells")
![Immunohistochemistry-Paraffin: ACADS Antibody [NBP1-89290] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.](http://images.novusbio.com/fullsize/ACADS-Antibody-Immunohistochemistry-Paraffin-NBP1-89290-img0015.jpg "Immunohistochemistry-Paraffin: ACADS Antibody [NBP1-89290] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.")
![Immunohistochemistry-Paraffin: ACADS Antibody [NBP1-89290] - Staining of human duodenum shows strong cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/ACADS-Antibody-Immunohistochemistry-Paraffin-NBP1-89290-img0016.jpg "Immunohistochemistry-Paraffin: ACADS Antibody [NBP1-89290] - Staining of human duodenum shows strong cytoplasmic positivity in glandular cells.")
![Immunocytochemistry M-Cadherin/Cadherin-15 Antibody [Unconjugated]](https://images.novusbio.com/images2/M-Cadherin_AF4096_Immunocytochemistry_10159.jpg)
![Flow Cytometry M-Cadherin/Cadherin-15 Antibody [Unconjugated]](https://images.novusbio.com/images2/M-Cadherin_AF4096_Flow_Cytometry_8228.jpg)
![Western Blot M-Cadherin/Cadherin-15 Antibody [Unconjugated]](https://images.novusbio.com/images2/M-Cadherin_AF4096_Western_Blot_9440.jpg)
![Western Blot BRCA2 Antibody (234403) [Unconjugated]](https://images.novusbio.com/images2/BRCA2_MAB2476_Western_Blot_6033.jpg)
![Immunohistochemistry BRCA2 Antibody (234403) [Unconjugated]](https://images.novusbio.com/images2/mab2476_human-brca2-mab-clone-234403-immunohistochemistry-10520211657.jpg)
![Western Blot BRCA2 Antibody (234403) [Unconjugated]](https://images.novusbio.com/images/mab2476_human-brca2-mab-clone-234403-2282024172111.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")