I have two options for ABCG8 primary antibodies from Novus Biologicals which we can use for fluorescence microscopy. Both of them have not been used/ tested in caco-2 cells (human colon carcinoma cell line) which is our model but for the below: 1) Used for IHC-P in liver, tonsil tissues (species human) NBP1-83388. Used for IHC-P in mouse intestine (species - mouse) NBP1-71706SS Out of the above two which do you and your team think will be more applicable for our purpose.

Name: ABCG8 Antibody
Brand: Novus Biologicals
SKU: NBP1-83388
Price: 519 USD

Question

I have two options for ABCG8 primary antibodies from Novus Biologicals which we can use for fluorescence microscopy. Both of them have not been used/ tested in caco-2 cells (human colon carcinoma cell line) which is our model but for the below: 1) Used for IHC-P in liver, tonsil tissues (species human) NBP1-83388. Used for IHC-P in mouse intestine (species - mouse) NBP1-71706SS Out of the above two which do you and your team think will be more applicable for our purpose.

Accepted Answer

I have spoken to our team and we would recommend using NBP1-83388 and applying for our Innovators Reward Program. Because you are doing ICC staining and we have only tested in tissue. Since it is confirmed to react with human and stain tissue it should probably be a better candidate than testing one which has worked in mouse samples, but not been shown to detect the human form of the protein.

At	=	A. thaliana	SyHa	=	Golden Syrian Hamster
All	=	All Species	Ha	=	Hamster
An	=	Animal	Hu	=	Human
ArHa	=	Armenian Hamster	I	=	Insect
Av	=	Avian	Ll	=	Llama
Bb	=	Baboon	Ma	=	Mammal
Ba	=	Bacteria	Mk	=	Monkey
Bv	=	Bovine	Mu	=	Mouse
Ca	=	Canine	Multi	=	Multi-species
Ce	=	C. Elegans	NA	=	Non-species specific
Ch	=	Chicken	Or	=	Orangutan
ChHa	=	Chinese Hamster	Pl	=	Plant
Cm	=	Cynomolgus Monkey	Pm	=	Primate
Do	=	Donkey	Po	=	Porcine
Dr	=	Drosophilia	Rb	=	Rabbit
Ec	=	E. Coli	Rt	=	Rat
Eq	=	Equine	RM	=	Rhesus Macaque
Fe	=	Feline	Sh	=	Sheep
Ft	=	Ferret	Vb	=	Vertebrate
Fi	=	Fish	Vi	=	Virus
Fu	=	Fungi	Xp	=	Xenopus
Ge	=	Gerbil	Ye	=	Yeast
GP	=	Guinea Pig	Ze	=	Zebrafish
Gt	=	Goat

Reactivity	HuSpecies Glossary
Applications	IHC
Clonality	Polyclonal
Host	Rabbit
Conjugate	Unconjugated

Immunogen	This antibody was developed against Recombinant Protein corresponding to amino acids: HMVQYFTAIGYPCPRYSNPADFYVDLTSIDRRSREQELATREKAQSLAALFLEKVRDLDDFLWKAETKDLDEDTCVESSVTPLDTNCLPSPTKMPGAVQQFTTLIRRQISNDFRDLP
Isotype	IgG
Clonality	Polyclonal
Host	Rabbit
Gene	ABCG8
Purity	Immunogen affinity purified
Innovator's Reward	Test in a species/application not listed above to receive a full credit towards a future purchase. Learn about the Innovator's Reward

Storage	Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer	PBS (pH 7.2) and 40% Glycerol
Preservative	0.02% Sodium Azide
Purity	Immunogen affinity purified

Publications using NBP1-83388	Applications	Species
Ahn SB, Jun DW, Jang K et al. Duodenal Niemann-Pick C1-like 1 expression was negatively correlated with liver X receptor expression in nonalcoholic fatty liver disease Korean J. Intern. Med. 2019-07-01 [PMID: 29466845] (IHC-P, Human)	IHC-P	Human
Ahn Sang Bong, Jang Kiseok, Jun Dae Won et al. Expression of liver X receptor correlates with intrahepatic inflammation and fibrosis in patients with nonalcoholic fatty liver disease. Dig Dis Sci. 2014-08-08 [PMID: 25102981] (Human)		Human

ABCG8 Antibody

Species Glossary

Images

Product Details

Order Details

ABCG8 Antibody Summary

Applications/Dilutions

Packaging, Storage & Formulations

Alternate Names for ABCG8 Antibody

Background

Limitations

Customers Who Viewed This Item Also Viewed...

Publications for ABCG8 Antibody (NBP1-83388)(2)

Reviews for ABCG8 Antibody (NBP1-83388) (0)

Product General Protocols

FAQs for ABCG8 Antibody (NBP1-83388). (Showing 1 - 1 of 1 FAQs).

Secondary Antibodies

Isotype Controls

Additional ABCG8 Products

Research Areas for ABCG8 Antibody (NBP1-83388)

Blogs on ABCG8.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Review this Product

Bioinformatics

Gene Symbol	ABCG8
Entrez	64241(Human)
Uniprot	Q9H221(Human)