![Western Blot: ZEB2 Antibody [NBP1-82991] - Analysis in human cell lines SK-MEL-30 and Caco-2 using Anti-ZEB2 antibody. Corresponding ZEB2 RNA-seq data are presented for the same cell lines. Loading control: Anti-HDAC1.](http://images.novusbio.com/fullsize/ZEB2-Antibody-Western-Blot-NBP1-82991-img0013.jpg "Western Blot: ZEB2 Antibody [NBP1-82991] - Analysis in human cell lines SK-MEL-30 and Caco-2 using Anti-ZEB2 antibody. Corresponding ZEB2 RNA-seq data are presented for the same cell lines. Loading control: Anti-HDAC1.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, Flow, ICC/IF, IHC, KD |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: SPVKPMDSITSPSIAELHNSVTNCDPPLRLTKPSHFTNIKPVEKLDHSRSNTPSPLNLSSTSSKNSHSSSYTPNSFSSEELQAEPLDLSLPKQMKEPKSIIATKNKTKASSISLDHNSVSSSSE |
| Predicted Species | Rat (95%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | ZEB2 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
||
| Reviewed Applications |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Immunocytochemistry E-Cadherin Antibody [Unconjugated]](https://images.novusbio.com/images2/ECadherin_AF748_Immunocytochemistry_15885.jpg)
![Immunohistochemistry E-Cadherin Antibody [Unconjugated]](https://images.novusbio.com/images2/ECadherin_AF748_Immunohistochemistry_15886.jpg)
![Immunocytochemistry E-Cadherin Antibody [Unconjugated]](https://images.novusbio.com/images2/ECadherin_AF748_Immunocytochemistry_16572.jpg)
| Images | Ratings | Applications | Species | Date | Details | ||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Enlarge |
reviewed by:
Xizi Wu |
IHC-Fr | Mouse | 11/08/2019 |
Summary
Comments
|
||||||||||
Enlarge |
reviewed by:
Verified Customer |
WB | Human | 11/12/2017 |
Summary
Comments
|
Secondary Antibodies |
Isotype Controls |
Research Areas for ZEB2 Antibody (NBP1-82991)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
5 | |
4 | |
3 | |
2 | |
1 |
| Xizi Wu 11/08/2019 |
||
| Application: | IHC-Fr | |
| Species: | Mouse |
| Verified Customer 11/12/2017 |
||
| Application: | WB | |
| Species: | Human |
| Gene Symbol | ZEB2 |
![Western Blot: ZEB2 Antibody [NBP1-82991] - Depletion of TRIM14 increased ZEB2 polyubiquitination and proteasomal degradation. Western blot analysis of TRIM14, ZEB2 and beta-actin in LN229 and U251 cells transduced with the indicated shRNA in the absence or presence of 10uM MG132. Image collected and cropped by CiteAb from the following publication (//jeccr.biomedcentral.com/articles/10.1186/s13046-019-1070-x), licensed under a CC-BY license.](http://images.novusbio.com/fullsize/ZEB2-Antibody-Western-Blot-NBP1-82991-img0018.jpg "Western Blot: ZEB2 Antibody [NBP1-82991] - Depletion of TRIM14 increased ZEB2 polyubiquitination and proteasomal degradation. Western blot analysis of TRIM14, ZEB2 and beta-actin in LN229 and U251 cells transduced with the indicated shRNA in the absence or presence of 10uM MG132. Image collected and cropped by CiteAb from the following publication (//jeccr.biomedcentral.com/articles/10.1186/s13046-019-1070-x), licensed under a CC-BY license.")
![Immunohistochemistry-Paraffin: ZEB2 Antibody [NBP1-82991] - Staining of human pancreas shows no positivity as expected.](http://images.novusbio.com/fullsize/ZEB2-Antibody-Immunohistochemistry-Paraffin-NBP1-82991-img0017.jpg "Immunohistochemistry-Paraffin: ZEB2 Antibody [NBP1-82991] - Staining of human pancreas shows no positivity as expected.")
![Immunohistochemistry-Paraffin: ZEB2 Antibody [NBP1-82991] - Staining of human cerebral cortex shows moderate nuclear positivity in glial cells.](http://images.novusbio.com/fullsize/ZEB2-Antibody-Immunohistochemistry-Paraffin-NBP1-82991-img0014.jpg "Immunohistochemistry-Paraffin: ZEB2 Antibody [NBP1-82991] - Staining of human cerebral cortex shows moderate nuclear positivity in glial cells.")
![Immunohistochemistry-Paraffin: ZEB2 Antibody [NBP1-82991] - Staining of human colon shows moderate nuclear positivity in a subset of lymphoid cells.](http://images.novusbio.com/fullsize/ZEB2-Antibody-Immunohistochemistry-Paraffin-NBP1-82991-img0015.jpg "Immunohistochemistry-Paraffin: ZEB2 Antibody [NBP1-82991] - Staining of human colon shows moderate nuclear positivity in a subset of lymphoid cells.")
![Immunohistochemistry-Paraffin: ZEB2 Antibody [NBP1-82991] - Staining of human glioma shows moderate nuclear positivity in tumor cells.](http://images.novusbio.com/fullsize/ZEB2-Antibody-Immunohistochemistry-Paraffin-NBP1-82991-img0016.jpg "Immunohistochemistry-Paraffin: ZEB2 Antibody [NBP1-82991] - Staining of human glioma shows moderate nuclear positivity in tumor cells.")
![SU5402, FGFR1 inhibitor, affects the EMT transcription factors.(A, B) ERK1/2 phosphorylation (p-ERK1/2) was determined by immunoblotting in HSC-4 & OTC-04 treated for 30 min with 30 ng/ml FGF2 or 30 ng/ml FGF7 in presence of 10% FBS (A) & in TSU & HOC313 cells treated for 1 h with 30 ng/ml FGF2 or 30 μM SU5402 in absence of FBS (B). F2, FGF2; F7, FGF7; SU, SU5402. (C) We have previously reported that, after treatment with TGF-beta , NMuMG cells underwent EMT with the IIIc-isoform of FGFR1[17]. After NMuMG cells pretreated with TGF-beta were transfected with mouse Fgfr1 siRNA or treated with SU5402, the cells were further incubated in culture medium (CM) from TSU cells. SU, SU5402; siFR1, siRNA against mouse Fgfr1. (D)FGF2 mRNA levels were determined by RT-qPCR analyses. The ratio of FGF2 mRNA to GAPDH mRNA in HSC-4 cells was indicated as “1”. Each value represents the mean ± SD of triplicate determinations from a representative experiment. Similar results obtained in at least three independent experiments. (E) ERK1/2 phosphorylation (p-ERK1/2) in TSU & HOC313 cells were monitored in presence of indicated concentration of SU5402 for 1 h under serum-free culture conditions, followed by immunoblot analysis. (F, G) Expression of indicated genes in TSU cells under serum-free culture conditions was determined by RT-qPCR (F) & immunoblot (G) analyses, following treatment with 10 μM SU5402. Each value represents the mean ± SD of triplicate determinations from a representative experiment. Similar results obtained from at least three independent experiments. p values were determined by Student’s t-test. **p < 0.01. (H) TSU cells treated with 10 μM U0126 in absence of FBS were subjected to immunoblotting with the indicated antibodies. alpha -tubulin was used as a loading control (A, B, C, E, G, & H). Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/31682640), licensed under a CC-BY license. Not internally tested by Novus Biologicals.](http://images.novusbio.com/fullsize/nbp1-82991_rabbit-polyclonal-zeb2-antibody-21020242345489.jpg "SU5402, FGFR1 inhibitor, affects the EMT transcription factors.(A, B) ERK1/2 phosphorylation (p-ERK1/2) was determined by immunoblotting in HSC-4 & OTC-04 treated for 30 min with 30 ng/ml FGF2 or 30 ng/ml FGF7 in presence of 10% FBS (A) & in TSU & HOC313 cells treated for 1 h with 30 ng/ml FGF2 or 30 μM SU5402 in absence of FBS (B). F2, FGF2; F7, FGF7; SU, SU5402. (C) We have previously reported that, after treatment with TGF-beta , NMuMG cells underwent EMT with the IIIc-isoform of FGFR1[17]. After NMuMG cells pretreated with TGF-beta were transfected with mouse Fgfr1 siRNA or treated with SU5402, the cells were further incubated in culture medium (CM) from TSU cells. SU, SU5402; siFR1, siRNA against mouse Fgfr1. (D)FGF2 mRNA levels were determined by RT-qPCR analyses. The ratio of FGF2 mRNA to GAPDH mRNA in HSC-4 cells was indicated as “1”. Each value represents the mean ± SD of triplicate determinations from a representative experiment. Similar results obtained in at least three independent experiments. (E) ERK1/2 phosphorylation (p-ERK1/2) in TSU & HOC313 cells were monitored in presence of indicated concentration of SU5402 for 1 h under serum-free culture conditions, followed by immunoblot analysis. (F, G) Expression of indicated genes in TSU cells under serum-free culture conditions was determined by RT-qPCR (F) & immunoblot (G) analyses, following treatment with 10 μM SU5402. Each value represents the mean ± SD of triplicate determinations from a representative experiment. Similar results obtained from at least three independent experiments. p values were determined by Student’s t-test. **p < 0.01. (H) TSU cells treated with 10 μM U0126 in absence of FBS were subjected to immunoblotting with the indicated antibodies. alpha -tubulin was used as a loading control (A, B, C, E, G, & H). Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/31682640), licensed under a CC-BY license. Not internally tested by Novus Biologicals.")
![Western Blot: ZEB2 Antibody [NBP1-82991] - ZEB2 is a downstream target of TRIM14. a Western blot analysis of TRIM14, EMT related biomarks (Snail1, Twist1, ZEB1, ZEB2 & SLUG), & beta -actin in LN229 & U251 cells transfected with shTRIM14–1, shTRIM14–2 or control shRNA. b Western blot analysis of TRIM14, N-cadherin, E-cadherin, Vimentin & beta -actin in LN229 & U251 cells transduced with the indicated plasmid. c Representative images of transwell invasion assay using LN229 & U251 cells transfected with the indicated plasmid. Quantification of transwell invasion assay is shown. ***p < 0.001; n = 3 experiment. d Representative images of wound healing assay using LN229 & U251 cells with the indicated plasmid. Quantification of wound healing assay is shown. ***p < 0.001, n = 3 experiments. e Representative images of 3D spheroid BME cell invasion assays using LN229 & U251 cells with the indicated plasmid. Quantification of 3D spheroid BME cell invasion assays is shown. ***p < 0.001, n = 3 experiments Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/30728039), licensed under a CC-BY license. Not internally tested by Novus Biologicals.](http://images.novusbio.com/fullsize/nbp1-82991_rabbit-polyclonal-zeb2-antibody-310202416121912.jpg "Western Blot: ZEB2 Antibody [NBP1-82991] - ZEB2 is a downstream target of TRIM14. a Western blot analysis of TRIM14, EMT related biomarks (Snail1, Twist1, ZEB1, ZEB2 & SLUG), & beta -actin in LN229 & U251 cells transfected with shTRIM14–1, shTRIM14–2 or control shRNA. b Western blot analysis of TRIM14, N-cadherin, E-cadherin, Vimentin & beta -actin in LN229 & U251 cells transduced with the indicated plasmid. c Representative images of transwell invasion assay using LN229 & U251 cells transfected with the indicated plasmid. Quantification of transwell invasion assay is shown. ***p < 0.001; n = 3 experiment. d Representative images of wound healing assay using LN229 & U251 cells with the indicated plasmid. Quantification of wound healing assay is shown. ***p < 0.001, n = 3 experiments. e Representative images of 3D spheroid BME cell invasion assays using LN229 & U251 cells with the indicated plasmid. Quantification of 3D spheroid BME cell invasion assays is shown. ***p < 0.001, n = 3 experiments Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/30728039), licensed under a CC-BY license. Not internally tested by Novus Biologicals.")
![Western Blot: ZEB2 Antibody [NBP1-82991] - TRIM14 function was demonstrated in vivo & IHC. a ShCtrl-transplanted & shTRIM14-transplanted LN229 cells were counted & transplanted in orthotopic nude mice model respectively, n = 6. b Survival curve of shCtrl-transplanted or shTRIM14-transplanted intracranial xenografts. ***, P < 0.001, n = 6. c Representative pseudocolour bioluminescence images of orthotopic tumours bearing control or TRIM14-depleted LN229 cells on the days as indicated. Quantification of tumor volume is shown. ***p < 0.001; n = 3 experiment. d The HE assay was performed to show tumor cytostructure. e Western blot analysis of TRIM14 & ZEB2 extracted from four pairs mice from shCtrl-transplanted group & shCtrl-transplanted group. Equal loading is confirmed by beta -actin levels. f IHC staining of TRIM14 & ZEB2 in four representative GBM specimens Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/30728039), licensed under a CC-BY license. Not internally tested by Novus Biologicals.](http://images.novusbio.com/fullsize/nbp1-82991_rabbit-polyclonal-zeb2-antibody-310202416113532.jpg "Western Blot: ZEB2 Antibody [NBP1-82991] - TRIM14 function was demonstrated in vivo & IHC. a ShCtrl-transplanted & shTRIM14-transplanted LN229 cells were counted & transplanted in orthotopic nude mice model respectively, n = 6. b Survival curve of shCtrl-transplanted or shTRIM14-transplanted intracranial xenografts. ***, P < 0.001, n = 6. c Representative pseudocolour bioluminescence images of orthotopic tumours bearing control or TRIM14-depleted LN229 cells on the days as indicated. Quantification of tumor volume is shown. ***p < 0.001; n = 3 experiment. d The HE assay was performed to show tumor cytostructure. e Western blot analysis of TRIM14 & ZEB2 extracted from four pairs mice from shCtrl-transplanted group & shCtrl-transplanted group. Equal loading is confirmed by beta -actin levels. f IHC staining of TRIM14 & ZEB2 in four representative GBM specimens Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/30728039), licensed under a CC-BY license. Not internally tested by Novus Biologicals.")
![Western Blot: ZEB2 Antibody [NBP1-82991] - ZEB2 is involved in the function of TRIM14. a Western blot analysis of TRIM14, EMT related biomarks (Snail1, Twist1, ZEB1, ZEB2 & SLUG), & beta -actin in HS683 & U87 cells transfected with vector or TRIM14. b Western blot analysis of TRIM14, N-cadherin, E-cadherin, Vimentin & beta -actin in HS683 & U87 cells transduced with the indicated plasmid. c Representative images of transwell invasion assay using HS683 & U87 cells transfected with the indicated plasmid. Quantification of transwell invasion assay is shown. ***p < 0.001; n = 3 experiment. d Representative images of wound healing assay using HS683 & U87 cells with the indicated plasmid. Quantification of wound healing assay is shown. ***p < 0.001, n = 3 experiments. e Representative images of 3D spheroid BME cell invasion assays using HS683 & U87 cells with the indicated plasmid. Quantification of 3D spheroid BME cell invasion assays is shown. ***p < 0.001, n = 3 experiments Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/30728039), licensed under a CC-BY license. Not internally tested by Novus Biologicals.](http://images.novusbio.com/fullsize/nbp1-82991_rabbit-polyclonal-zeb2-antibody-310202416121955.jpg "Western Blot: ZEB2 Antibody [NBP1-82991] - ZEB2 is involved in the function of TRIM14. a Western blot analysis of TRIM14, EMT related biomarks (Snail1, Twist1, ZEB1, ZEB2 & SLUG), & beta -actin in HS683 & U87 cells transfected with vector or TRIM14. b Western blot analysis of TRIM14, N-cadherin, E-cadherin, Vimentin & beta -actin in HS683 & U87 cells transduced with the indicated plasmid. c Representative images of transwell invasion assay using HS683 & U87 cells transfected with the indicated plasmid. Quantification of transwell invasion assay is shown. ***p < 0.001; n = 3 experiment. d Representative images of wound healing assay using HS683 & U87 cells with the indicated plasmid. Quantification of wound healing assay is shown. ***p < 0.001, n = 3 experiments. e Representative images of 3D spheroid BME cell invasion assays using HS683 & U87 cells with the indicated plasmid. Quantification of 3D spheroid BME cell invasion assays is shown. ***p < 0.001, n = 3 experiments Image collected & cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/30728039), licensed under a CC-BY license. Not internally tested by Novus Biologicals.")
![Western Blot Snail Antibody [Unconjugated]](https://images.novusbio.com/images2/Snail_AF3639_Western_Blot_5320.jpg)
![Intracellular Staining by Flow Cytometry Snail Antibody [Unconjugated]](https://images.novusbio.com/images2/Snail_AF3639_Flow_Cytometry_20834.jpg)
![Chromatin Immunoprecipitation (ChIP) Snail Antibody [Unconjugated]](https://images.novusbio.com/images2/Snail_AF3639_Chromatin_Immunoprecipitation_11236.jpg)
![N/A MMP-2 [HRP]](https://images.novusbio.com/images2/DATA_MMP2_MMP200_ELISA_1003.jpg)
![N/A MMP-2 [HRP]](https://images.novusbio.com/images2/MMP2_MMP200_ELISA_474.jpg)
![Bioactivity TGF-beta 1 [Unconjugated]](https://images.novusbio.com/images/protein/7754-bhcf_recombinant-human-tgf-beta-1-human-cell-expressed-cf-bioactivity-1811202013946.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")
