![Western Blot: ZCCHC6 Antibody [H00079670-B01P] - Analysis of ZCCHC6 expression in human liver.](http://images.novusbio.com/fullsize/ZCCHC6-Antibody-Western-Blot-H00079670-B01P-img0003.jpg "Western Blot: ZCCHC6 Antibody [H00079670-B01P] - Analysis of ZCCHC6 expression in human liver.")
| Reactivity | HuSpecies Glossary |
| Applications | WB |
| Clonality | Polyclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Immunogen | ZCCHC6 (AAH32456, 1 a.a. - 412 a.a.) full-length human protein. MGDTAKPYFVKRTKDRGTMDDDDFRRGHPQQDYLIIDDHAKGHGSKMEKGLQKKKITPGNYGNTPRKGPCAVSSNPYAFKNPIYSQPAWMNDSHKDQSKRWLSDEHTGNSDNWREFKPGPRIPVINRQRKDSFQENEDGYRWQDTRGCRTVRRLFHKDLTSLETTSEMEAGSPENKKQRSRPRKPRKTRNEENEQDGDLEGPVIDESVLSTKELLGLQQAEERLKRDCIDRLKRRPRNYPTAKYTCRLCDVLIESIAFAHKHIKEKRHKKNIKEKQEEELLTTLPPPTPSQINAVGIAIDKVVQEFGLHNENLEQRLEIKRIMENVFQHKLPDCSLRLYGSSCSRLGFKNSDVNIDIQFPAIMSQPDVLLLVQECLKNSDSFIDVDADFHARVPVVVCREKQRSHFFKLFIY |
| Specificity | ZCCHC6 - zinc finger, CCHC domain containing 6, |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Mouse |
| Gene | TUT7 |
| Purity | Protein A purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Application Notes | Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control. |
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.4) |
| Preservative | No Preservative |
| Purity | Protein A purified |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Western Blot: ZCCHC6 Antibody [H00079670-B01P] - Analysis of ZCCHC6 expression in transfected 293T cell line by ZCCHC6 polyclonal antibody. Lane 1: ZCCHC6 transfected lysate(45.32 KDa). Lane 2: Non-transfected lysate.](http://images.novusbio.com/fullsize/ZCCHC6-Antibody-Western-Blot-H00079670-B01P-img0004.jpg "Western Blot: ZCCHC6 Antibody [H00079670-B01P] - Analysis of ZCCHC6 expression in transfected 293T cell line by ZCCHC6 polyclonal antibody. Lane 1: ZCCHC6 transfected lysate(45.32 KDa). Lane 2: Non-transfected lysate.")
![Western Blot CBP/KAT3A Antibody (257003) [Unconjugated]](https://images.novusbio.com/images2/CBP_MAB2676_Western_Blot_6043.jpg)
![Immunocytochemistry CBP/KAT3A Antibody (257003) [Unconjugated]](https://images.novusbio.com/images2/mab2676_human-mouse-rat-cbp-mab-clone-257003-immunocytochemistry-101220208237.jpg)
![N/A Erythropoietin/EPO [HRP]](https://images.novusbio.com/images2/DATA_Erythropoietin_MEP00_ELISA_970.jpg)
![N/A Erythropoietin/EPO [HRP]](https://images.novusbio.com/images2/Erythropoietin_MEP00_ELISA_421.jpg)
![Simple Western PAG1 Antibody (504004) [Unconjugated]](https://images.novusbio.com/images2/PAG1_MAB5285_Simple_Western_16616.jpg)
![Western Blot PAG1 Antibody (504004) [Unconjugated]](https://images.novusbio.com/images2/PAG1_MAB5285_Western_Blot_9455.jpg)
![Flow Cytometry: Mouse IgG Isotype Control [NBP1-97019]](https://images.novusbio.com/images/Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP1-97019-img0004.jpg "Flow Cytometry: Mouse IgG Isotype Control [NBP1-97019]")