Home » ZBP1/DLM-1/DAI » DAI Peptides and Proteins » Recombinant Human ZBP1/DLM-1/DAI GST (N-Term) Protein
Novus Biologicals products are now on bio-techne.com

Recombinant Human ZBP1/DLM-1/DAI GST (N-Term) Protein

 Submit a Review

Images

 
(
Enlarge)
12.5% SDS-PAGE Stained with Coomassie Blue.
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, MA, AP

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

Recombinant Human ZBP1/DLM-1/DAI GST (N-Term) Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-149 of Human ZBP1

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MAQAPADPGREGHLEQRILQVLTEAGSPVKLAQLVKECQAPKRELNQVLYRMKKELKVSLTSPATWCLGGTDPEGEGPAELALSSPGNCHPGEAGLTLQGASWQWTSTDLSLGSNLNSATWELTGFLSLCLGFFFWLMELTAGLLGRGC
Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
ZBP1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
42.4 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human ZBP1/DLM-1/DAI GST (N-Term) Protein

  • C20orf183
  • chromosome 20 open reading frame 183
  • DAI
  • DLM1
  • DLM-1
  • DLM1dJ718J7.3
  • DNA-dependent activator of interferon regulatory factors
  • DNA-dependent activator of IRFs
  • Tumor stroma and activated macrophage protein DLM-1
  • ZBP1 Z-DNA binding protein 1
  • ZBP1
  • Z-DNA binding protein 1
  • Z-DNA-binding protein 1

Background

DLM1 encodes a Z-DNA binding protein. Z-DNA formation is a dynamic process, largely controlled by the amount of supercoiling.[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

TNF-alpha
[Unconjugated]
210-TA
SDS-PAGE TNF-alpha [Unconjugated]
Bioactivity TNF-alpha [Unconjugated]
SEC-MALS TNF-alpha [Unconjugated]
(3 Reviews)
(817 Publications)
Species: Hu
Applications: BA

Myeloperoxidase/MPO An ...
AF3667
Western Blot Myeloperoxidase/MPO Antibody [Unconjugated]
Simple Western Myeloperoxidase/MPO Antibody [Unconjugated]
Immunocytochemistry Myeloperoxidase/MPO Antibody [Unconjugated]
(3 Reviews)
(167 Publications)
Species: Hu, Mu
Applications: Dual ISH-IHC, ICC, IHC, Simple Western, WB
Myelin Protein
Zero Antibody
NB100-1607
Immunohistochemistry Myelin Protein Zero Antibody
Immunocytochemistry/ Immunofluorescence Myelin Protein Zero Antibody
(16 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IP, WB
DAX1/NR0B1
Antibody (H7431)
PP-H7431-00
DAX1/NR0B1 Antibody (H7431)
(2 Publications)
Species: Hu
Applications: WB
PMP22 Antibody
(Hu1) - Azide and BSA ...
NBP2-80913
Immunohistochemistry PMP22 Antibody (Hu1) - Azide and BSA Free
Species: Bv(-), Hu, Mu(-), Pm, Rt(-)
Applications: IHC, IHC-P, WB
IRF3 Antibody
(SD2062)
NBP2-67741
Immunocytochemistry/ Immunofluorescence IRF3 Antibody (SD2062)
Immunocytochemistry/ Immunofluorescence IRF3 Antibody (SD2062)
Immunohistochemistry-Paraffin IRF3 Antibody (SD2062)
(2 Publications)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
TLR9 Antibody
(26C593.2) - BSA Free
NBP2-24729
Immunohistochemistry-Paraffin TLR9 Antibody (26C593.2) - BSA Free
Flow Cytometry TLR9 Antibody (26C593.2) - BSA Free
Flow Cytometry TLR9 Antibody (26C593.2) - BSA Free
(4 Reviews)
(155 Publications)
Species: Ca, Eq, Hu, Pm, Mu, Pm, Rt
Applications: B/N, CyTOF-ready, DB, ELISA, Flow-IC, Flow, Func, ICC/IF, IHC, IHC-P, IP, In vitro, KD, Simple Western, WB
IL-6 [HRP]
M6000B
N/A IL-6 [HRP]
N/A IL-6 [HRP]
N/A IL-6 [HRP]
(663 Publications)
Species: Mu
Applications: ELISA
IGF2BP1 Antibody
NBP2-38956
Simple Western IGF2BP1 Antibody
Simple Western IGF2BP1 Antibody
Western Blot IGF2BP1 Antibody
Species: Hu
Applications: IHC, IHC-P, Simple Western, WB
NFkB p105/p50
Antibody (2J10D7) - B ...
NB100-56583
Flow Cytometry NFkB p105/p50 Antibody (2J10D7) - BSA Free
Flow Cytometry NFkB p105/p50 Antibody (2J10D7) - BSA Free
Flow Cytometry NFkB p105/p50 Antibody (2J10D7) - BSA Free
(1 Review)
(5 Publications)
Species: Hu, Rb, Rt
Applications: Flow, IHC, IHC-P, KO, WB
IL-10 [Biotin]
DY417
N/A IL-10 [Biotin]
(302 Publications)
Species: Mu
Applications: ELISA
AIM2 Antibody
(10M5G5)
NBP2-27354
Western Blot AIM2 Antibody (10M5G5)
Western Blot AIM2 Antibody (10M5G5)
(1 Publication)
Species: Hu
Applications: WB
TBK1 Antibody
(108A429) - BSA Free
NB100-56705
Immunohistochemistry-Paraffin TBK1 Antibody (108A429) - BSA Free
Immunocytochemistry/ Immunofluorescence TBK1 Antibody (108A429) - BSA Free
Simple Western TBK1 Antibody (108A429) - BSA Free
(2 Reviews)
(29 Publications)
Species: Bv, Ca, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, KO, Simple Western, WB
ADAR Antibody
(CL0176)
NBP3-05500
Immunocytochemistry/ Immunofluorescence ADAR Antibody (CL0176)
Immunohistochemistry-Paraffin ADAR Antibody (CL0176)
Immunohistochemistry-Paraffin ADAR Antibody (CL0176)
(1 Publication)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
RIPK1/RIP1
Antibody - BSA Free
NBP1-77077
Immunocytochemistry/ Immunofluorescence RIPK1/RIP1 Antibody - BSA Free
Western Blot RIPK1/RIP1 Antibody - BSA Free
Immunohistochemistry RIPK1/RIP1 Antibody - BSA Free
(1 Review)
(21 Publications)
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, KD, WB
RIG-I Antibody
AF4859
Western Blot RIG-I Antibody
(2 Publications)
Species: Hu
Applications: WB
RIPK3/RIP3
Antibody - BSA Free
NBP1-77299
Immunocytochemistry/ Immunofluorescence RIPK3/RIP3 Antibody - BSA Free
Immunohistochemistry-Paraffin RIPK3/RIP3 Antibody - BSA Free
Western Blot RIPK3/RIP3 Antibody - BSA Free
(1 Review)
(78 Publications)
Species: Hu, Mu, Rt
Applications: ELISA, GS, ICC/IF, IHC, IHC-P, IP, KD, KO, WB
COX5A Antibody
NBP1-32550
Western Blot COX5A Antibody
Immunohistochemistry-Paraffin COX5A Antibody
Western Blot COX5A Antibody
(3 Publications)
Species: Hu, Mu, Ze
Applications: ICC/IF, IHC, IHC-P, WB
beta-Actin
Antibody (AC-15)
NB600-501
Western Blot beta-Actin Antibody (AC-15)
Simple Western beta-Actin Antibody (AC-15)
Western Blot beta-Actin Antibody (AC-15)
(27 Reviews)
(595 Publications)
Species: Bv, Ca, Ch, Dr(-), Fe, Fi, Gp, Ha, Hu, Le, Ma, Mu, Po, Pm, Rb, Rt, Sh, Sq, Tr, Ze
Applications: ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, KO, Simple Western, WB
Signal Peptide
Peptidase Antibody
NBP2-32276
Western Blot Signal Peptide Peptidase Antibody
Immunoprecipitation Signal Peptide Peptidase Antibody
Species: Hu
Applications: IP, WB

Publications for ZBP1/DLM-1/DAI Recombinant Protein (H00081030-P01) (0)

There are no publications for ZBP1/DLM-1/DAI Recombinant Protein (H00081030-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZBP1/DLM-1/DAI Recombinant Protein (H00081030-P01) (0)

There are no reviews for ZBP1/DLM-1/DAI Recombinant Protein (H00081030-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ZBP1/DLM-1/DAI Recombinant Protein (H00081030-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ZBP1/DLM-1/DAI Products

Research Areas for ZBP1/DLM-1/DAI Recombinant Protein (H00081030-P01)

Find related products by research area.

Blogs on ZBP1/DLM-1/DAI

There are no specific blogs for ZBP1/DLM-1/DAI, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
TNF-alpha [Unconjugated]
210-TA-005

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human ZBP1/DLM-1/DAI GST (N-Term) Protein and receive a gift card or discount.


Bioinformatics

Gene Symbol ZBP1