![Immunohistochemistry-Paraffin: ADAR Antibody (CL0176) [NBP3-05500] - Analysis in human cerebral cortex and skeletal muscle tissues using NBP3-05500 antibody. Corresponding ADAR RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/ADAR-Antibody-CL0176-Immunohistochemistry-Paraffin-NBP3-05500-img0008.jpg "Immunohistochemistry-Paraffin: ADAR Antibody (CL0176) [NBP3-05500] - Analysis in human cerebral cortex and skeletal muscle tissues using NBP3-05500 antibody. Corresponding ADAR RNA-seq data are presented for the same tissues.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clone | CL0176 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: SDNQPEGMISESLDNLESMMPNKVRKIGELVRYLNTNPVGGLLEYARSHGFAAEFKLVDQSGPPHEPKFVYQAKVGGRWFPAVCAHSKKQGKQEAADAALRVLIGENEKAERMGFTEVTPVTGASLRRTMLLLSRSPEA |
| Isotype | IgG1 |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | ADAR |
| Purity | Protein A purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
|
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. For ICC/IF fixation permeabilization use PFA/Triton X-100. |
|
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS, pH 7.2, containing 40% glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Protein A purified |
![Western Blot PKLR Antibody [Unconjugated]](https://images.novusbio.com/images2/PKLR_AF8519_Western_Blot_16592.jpg)
![Simple Western PKLR Antibody [Unconjugated]](https://images.novusbio.com/images2/af8519_human-mouse-rat-pklr-affinity-purified-pab-simple-western-1342022154119.jpg)
![Western Blot beta-Catenin Antibody [Unconjugated]](https://images.novusbio.com/images2/beta-Catenin_AF1329_Western_Blot_5100.jpg)
![Chromatin Immunoprecipitation (ChIP) beta-Catenin Antibody [Unconjugated]](https://images.novusbio.com/images2/beta-Catenin_AF1329_Chromatin_Immunoprecipitation_11251.jpg)
![Simple Western beta-Catenin Antibody [Unconjugated]](https://images.novusbio.com/images2/betaCatenin_AF1329_Simple_Western_17134.jpg)
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | ADAR |
![Western Blot: ADAR Antibody (CL0176) [NBP3-05500] - Analysis in U-251MG cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-ADAR antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.](http://images.novusbio.com/fullsize/ADAR-Antibody-CL0176-Western-Blot-NBP3-05500-img0006.jpg "Western Blot: ADAR Antibody (CL0176) [NBP3-05500] - Analysis in U-251MG cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-ADAR antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.")
![Immunocytochemistry/Immunofluorescence: ADAR Antibody (CL0176) [NBP3-05500] - Staining of A549 cells using the Anti-ADAR monoclonal antibody, showing specific staining in the nucleoplasm and nucleoli in green. Microtubule- and nuclear probes are visualized in red and blue, respectively (where available).](http://images.novusbio.com/fullsize/ADAR-Antibody-CL0176-Immunocytochemistry-Immunofluorescence-NBP3-05500-img0001.jpg "Immunocytochemistry/Immunofluorescence: ADAR Antibody (CL0176) [NBP3-05500] - Staining of A549 cells using the Anti-ADAR monoclonal antibody, showing specific staining in the nucleoplasm and nucleoli in green. Microtubule- and nuclear probes are visualized in red and blue, respectively (where available).")
![Immunohistochemistry-Paraffin: ADAR Antibody (CL0176) [NBP3-05500] - Staining of human skeletal muscle shows no positivity in myocytes as expected.](http://images.novusbio.com/fullsize/ADAR-Antibody-CL0176-Immunohistochemistry-Paraffin-NBP3-05500-img0010.jpg "Immunohistochemistry-Paraffin: ADAR Antibody (CL0176) [NBP3-05500] - Staining of human skeletal muscle shows no positivity in myocytes as expected.")
![Immunohistochemistry-Paraffin: ADAR Antibody (CL0176) [NBP3-05500] - Staining of human cerebral cortex shows nuclear positivity.](http://images.novusbio.com/fullsize/ADAR-Antibody-CL0176-Immunohistochemistry-Paraffin-NBP3-05500-img0002.jpg "Immunohistochemistry-Paraffin: ADAR Antibody (CL0176) [NBP3-05500] - Staining of human cerebral cortex shows nuclear positivity.")
![Immunohistochemistry-Paraffin: ADAR Antibody (CL0176) [NBP3-05500] - Staining of human testis shows nuclear positivity.](http://images.novusbio.com/fullsize/ADAR-Antibody-CL0176-Immunohistochemistry-Paraffin-NBP3-05500-img0004.jpg "Immunohistochemistry-Paraffin: ADAR Antibody (CL0176) [NBP3-05500] - Staining of human testis shows nuclear positivity.")
![Immunohistochemistry-Paraffin: ADAR Antibody (CL0176) [NBP3-05500] - Staining of human kidney shows strong nuclear positivity in cells in tubules.](http://images.novusbio.com/fullsize/ADAR-Antibody-CL0176-Immunohistochemistry-Paraffin-NBP3-05500-img0009.jpg "Immunohistochemistry-Paraffin: ADAR Antibody (CL0176) [NBP3-05500] - Staining of human kidney shows strong nuclear positivity in cells in tubules.")
![Western Blot Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Western_Blot_5287.jpg)
![Simple Western Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Simple_Western_16990.jpg)
![Knockout Validated Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Knockout_Validated_24032.jpg)
![Western Blot BMP-1/PCP Antibody [Unconjugated]](https://images.novusbio.com/images2/BMP1_AF1927_Western_Blot_21018.jpg)
![Western Blot BMP-1/PCP Antibody [Unconjugated]](https://images.novusbio.com/images2/BMP1_AF1927_Western_Blot_21019.jpg)
![SDS-Page: Mouse IgG1 Isotype Control (MG1) [NBP1-97005] - Lane 1: , Non-reduced. M: Opal Pre-stained Ladder. Lane 2: , Reduced. Load: 1.0 ug per lane. Predicted/Observed: 120 kDa Non-reduced, 55 and 25 Reduced.](https://images.novusbio.com/images/Mouse-IgG1-Isotype-Control-MG1-SDS-Page-NBP1-97005-img0002.jpg "SDS-Page: Mouse IgG1 Isotype Control (MG1) [NBP1-97005] - Lane 1: , Non-reduced. M: Opal Pre-stained Ladder. Lane 2: , Reduced. Load: 1.0 ug per lane. Predicted/Observed: 120 kDa Non-reduced, 55 and 25 Reduced.")