![Immunohistochemistry-Paraffin: IGF2BP1 Antibody [NBP2-38956] - Staining in human testis and liver tissues using NBP2-38956 antibody. Corresponding IGF2BP1 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/IGF2BP1-Antibody-Immunohistochemistry-Paraffin-NBP2-38956-img0017.jpg "Immunohistochemistry-Paraffin: IGF2BP1 Antibody [NBP2-38956] - Staining in human testis and liver tissues using NBP2-38956 antibody. Corresponding IGF2BP1 RNA-seq data are presented for the same tissues.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, Simple Western, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: HALKVSYIPDEQIAQGPENGRRGGFGSRGQPRQGSPVAAGAPAKQQQVDI |
| Predicted Species | Mouse (96%), Rat (100%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | IGF2BP1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. In Simple Western only 10-15 uL of the recommended dilution is used per data point. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Western Blot beta-Catenin Antibody [Unconjugated]](https://images.novusbio.com/images2/beta-Catenin_AF1329_Western_Blot_5100.jpg)
![Chromatin Immunoprecipitation (ChIP) beta-Catenin Antibody [Unconjugated]](https://images.novusbio.com/images2/beta-Catenin_AF1329_Chromatin_Immunoprecipitation_11251.jpg)
![Simple Western beta-Catenin Antibody [Unconjugated]](https://images.novusbio.com/images2/betaCatenin_AF1329_Simple_Western_17134.jpg)
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunohistochemistry-Paraffin: IGF2BP1 Antibody [NBP2-38956] - Staining of human endometrium, ovary, pancreas and testis using Anti-IGF2BP1 antibody NBP2-38956 (A) shows similar protein distribution across tissues to independent antibody NBP1-83108 (B).](http://images.novusbio.com/fullsize/IGF2BP1-Antibody-Immunohistochemistry-Paraffin-NBP2-38956-img0013.jpg "Immunohistochemistry-Paraffin: IGF2BP1 Antibody [NBP2-38956] - Staining of human endometrium, ovary, pancreas and testis using Anti-IGF2BP1 antibody NBP2-38956 (A) shows similar protein distribution across tissues to independent antibody NBP1-83108 (B).")
![Western Blot: IGF2BP1 Antibody [NBP2-38956] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Human cell line CACO-2](http://images.novusbio.com/fullsize/IGF2BP1-Antibody-Western-Blot-NBP2-38956-img0007.jpg "Western Blot: IGF2BP1 Antibody [NBP2-38956] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Human cell line CACO-2")
![Immunohistochemistry-Paraffin: IGF2BP1 Antibody [NBP2-38956] - Staining of human ovary shows moderate cytoplasmic positivity in follicle cells.](http://images.novusbio.com/fullsize/IGF2BP1-Antibody-Immunohistochemistry-Paraffin-NBP2-38956-img0018.jpg "Immunohistochemistry-Paraffin: IGF2BP1 Antibody [NBP2-38956] - Staining of human ovary shows moderate cytoplasmic positivity in follicle cells.")
![Immunohistochemistry-Paraffin: IGF2BP1 Antibody [NBP2-38956] - Staining of human endometrium shows no positivity in glandular cells as expected.](http://images.novusbio.com/fullsize/IGF2BP1-Antibody-Immunohistochemistry-Paraffin-NBP2-38956-img0012.jpg "Immunohistochemistry-Paraffin: IGF2BP1 Antibody [NBP2-38956] - Staining of human endometrium shows no positivity in glandular cells as expected.")
![Immunohistochemistry-Paraffin: IGF2BP1 Antibody [NBP2-38956] - Staining of human liver shows no positivity in hepatocytes as expected.](http://images.novusbio.com/fullsize/IGF2BP1-Antibody-Immunohistochemistry-Paraffin-NBP2-38956-img0014.jpg "Immunohistochemistry-Paraffin: IGF2BP1 Antibody [NBP2-38956] - Staining of human liver shows no positivity in hepatocytes as expected.")
![Immunohistochemistry-Paraffin: IGF2BP1 Antibody [NBP2-38956] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.](http://images.novusbio.com/fullsize/IGF2BP1-Antibody-Immunohistochemistry-Paraffin-NBP2-38956-img0015.jpg "Immunohistochemistry-Paraffin: IGF2BP1 Antibody [NBP2-38956] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.")
![Immunohistochemistry-Paraffin: IGF2BP1 Antibody [NBP2-38956] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferous ducts.](http://images.novusbio.com/fullsize/IGF2BP1-Antibody-Immunohistochemistry-Paraffin-NBP2-38956-img0016.jpg "Immunohistochemistry-Paraffin: IGF2BP1 Antibody [NBP2-38956] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferous ducts.")
![Simple Western: IGF2BP1 Antibody [NBP2-38956] - Simple Western lane view shows a specific band for IGF2BP1 in 0.2 mg/ml of HT-29 (left) and HCT 116 (right) lysate(s). This experiment was performed under reducing conditions using the 12-230 kDa separation systems.](http://images.novusbio.com/fullsize/IGF2BP1-Antibody-Simple-Western-NBP2-38956-img0002.jpg "Simple Western: IGF2BP1 Antibody [NBP2-38956] - Simple Western lane view shows a specific band for IGF2BP1 in 0.2 mg/ml of HT-29 (left) and HCT 116 (right) lysate(s). This experiment was performed under reducing conditions using the 12-230 kDa separation systems.")
![Simple Western: IGF2BP1 Antibody [NBP2-38956] - Electropherogram image of the corresponding Simple Western lane view. IGF2BP1 antibody was used at 1:10 dilution on HT-29 and HCT 116 lysate(s) respectively.](http://images.novusbio.com/fullsize/IGF2BP1-Antibody-Simple-Western-NBP2-38956-img0003.jpg "Simple Western: IGF2BP1 Antibody [NBP2-38956] - Electropherogram image of the corresponding Simple Western lane view. IGF2BP1 antibody was used at 1:10 dilution on HT-29 and HCT 116 lysate(s) respectively.")
![SDS-PAGE IGF-II/IGF2 [Unconjugated]](https://images.novusbio.com/images2/IGF-II_292-G2_668.jpg)
![Bioactivity IGF-II/IGF2 [Unconjugated]](https://images.novusbio.com/images2/IGF-II_292-G2_669.jpg)
![N/A BDNF [HRP]](https://images.novusbio.com/images2/DATA_BDNF_DBD00_ELISA_587.jpg)
![N/A BDNF [HRP]](https://images.novusbio.com/images2/DATA_BDNF_DBD00_ELISA_588.jpg)
![N/A BDNF [HRP]](https://images.novusbio.com/images2/BDNF_DBD00_ELISA_36.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")