![Immunocytochemistry/Immunofluorescence: XK X-linked Kx blood group Antibody [NBP1-87828] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm & mitochondria.](http://images.novusbio.com/fullsize/XK-X-linked-Kx-blood-group-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-87828-img0007.jpg "Immunocytochemistry/Immunofluorescence: XK X-linked Kx blood group Antibody [NBP1-87828] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm & mitochondria.")
| Reactivity | HuSpecies Glossary |
| Applications | ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: DLSRDRPLVLLLHLLQLGPLFRCFEVFCIYFQSGNNEEPYVSITKKRQMPKNGLSEEIEKEVGQAEGKLITHRSAFSRA |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | XK |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Kell Antibody [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "Kell Antibody [Unconjugated]")
Secondary Antibodies |
Isotype Controls |
Research Areas for XK X-linked Kx blood group Antibody (NBP1-87828)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | XK |
![Immunohistochemistry-Paraffin: XK X-linked Kx blood group Antibody [NBP1-87828] - Staining of human heart muscle shows strong cytoplasmic positivity in cardiomyocytes.](http://images.novusbio.com/fullsize/XK-X-linked-Kx-blood-group-Antibody-Immunohistochemistry-Paraffin-NBP1-87828-img0010.jpg "Immunohistochemistry-Paraffin: XK X-linked Kx blood group Antibody [NBP1-87828] - Staining of human heart muscle shows strong cytoplasmic positivity in cardiomyocytes.")
![Immunocytochemistry/Immunofluorescence: XK X-linked Kx blood group Antibody [NBP1-87828] - Staining of human cell line U-2 OS shows positivity in mitochondria and vesicles.](http://images.novusbio.com/fullsize/XK-X-linked-Kx-blood-group-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-87828-img0005.jpg "Immunocytochemistry/Immunofluorescence: XK X-linked Kx blood group Antibody [NBP1-87828] - Staining of human cell line U-2 OS shows positivity in mitochondria and vesicles.")
![Immunohistochemistry-Paraffin: XK X-linked Kx blood group Antibody [NBP1-87828] - Staining of human stomach shows strong cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/XK-X-linked-Kx-blood-group-Antibody-Immunohistochemistry-Paraffin-NBP1-87828-img0006.jpg "Immunohistochemistry-Paraffin: XK X-linked Kx blood group Antibody [NBP1-87828] - Staining of human stomach shows strong cytoplasmic positivity in glandular cells.")
![Immunohistochemistry-Paraffin: XK X-linked Kx blood group Antibody [NBP1-87828] - Staining of human bone marrow shows moderate cytoplasmic positivity in erythropoietic cells.](http://images.novusbio.com/fullsize/XK-X-linked-Kx-blood-group-Antibody-Immunohistochemistry-Paraffin-NBP1-87828-img0008.jpg "Immunohistochemistry-Paraffin: XK X-linked Kx blood group Antibody [NBP1-87828] - Staining of human bone marrow shows moderate cytoplasmic positivity in erythropoietic cells.")
![Immunohistochemistry-Paraffin: XK X-linked Kx blood group Antibody [NBP1-87828] - Staining of human liver shows weak positivity in hepatocytes.](http://images.novusbio.com/fullsize/XK-X-linked-Kx-blood-group-Antibody-Immunohistochemistry-Paraffin-NBP1-87828-img0009.jpg "Immunohistochemistry-Paraffin: XK X-linked Kx blood group Antibody [NBP1-87828] - Staining of human liver shows weak positivity in hepatocytes.")
![Immunohistochemistry-Paraffin: XK X-linked Kx blood group Antibody [NBP1-87828] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferous ducts.](http://images.novusbio.com/fullsize/XK-X-linked-Kx-blood-group-Antibody-Immunohistochemistry-Paraffin-NBP1-87828-img0011.jpg "Immunohistochemistry-Paraffin: XK X-linked Kx blood group Antibody [NBP1-87828] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferous ducts.")
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")